PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03255g03008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 403aa    MW: 46218.9 Da    PI: 5.1319
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03255g03008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix72.95.7e-23293376186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW+k+ev++L+ +r  +++++ +g +k+  Weev++ ++++g+ r+pk+Ckekwen+nk+yk++ ++ k    ++ ++cpyf++l
  Niben101Scf03255g03008.1 293 RWPKSEVQDLVSIRIALDHKFFNG-AKGSVWEEVADGLAKKGYIRTPKKCKEKWENINKYYKRTIDSGKAC-LRNYRSCPYFREL 375
                               8********************999.99*****************************************997.456679*****99 PP

                  trihelix  86 e 86 
                               +
  Niben101Scf03255g03008.1 376 D 376
                               7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.015286349IPR017877Myb-like domain
CDDcd122032.35E-19292355No hitNo description
PfamPF138375.8E-18292376No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MELLTDFDGH RSNDVTTFPD NNLTPFPVST NAVYSHPASV VPPPPEIDHL PVSPARKLRP  60
VRCGNGRTYV DMVDFICDMD ETLMNCSSDL GGFFSRFSAQ NANTVIPREC GFEFSAVQQM  120
KSVFDADCFN LISQARVLEA EFSSSSDDSE SSETIEERLN RKRETRKSLK LYLEDVVKRL  180
MDKQEQMHKQ LIEMIEKKEH ARIIREEGWK QQEIERAKRD EEVRAEETSR NMALISFLEN  240
MLGDEFQIPE SSEMSSRVKD EGEVHGQEAD VKSDPCEVHG QEADVKSDPC NRRWPKSEVQ  300
DLVSIRIALD HKFFNGAKGS VWEEVADGLA KKGYIRTPKK CKEKWENINK YYKRTIDSGK  360
ACLRNYRSCP YFRELDILYK SHLLTQGTGD CVKSEAESKK VEE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771160.10.0PREDICTED: trihelix transcription factor GT-2
TrEMBLA0A1U7WAA50.0A0A1U7WAA5_NICSY; trihelix transcription factor GT-2
STRINGXP_009771160.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128841620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.11e-48Trihelix family protein