PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03056g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 524aa    MW: 57403.3 Da    PI: 8.8377
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03056g00007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42164239277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  Niben101Scf03056g00007.1 164 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 239
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.4E-34158225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.821161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-39162242IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MESWSYLSGG KGFISEESVS VNDGMGRTKN GFMVWELKTP SSYVMCSSQQ GSTSNQGFPE  60
LGSQNLMRKT MYSDQSIFGS VAASPSAAYS GENKSKSSSK LSSSVVESNS KDSSLIDLKL  120
GRFPDQIDAN VYKSPKIMPN VSCAESIVPA KRMRAGGVNS YPFCQVQGCG KDLSSCKDYH  180
KRHKVCEVHS KTAKVIVNGI EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG HNERRRKPHT  240
GTRFRGTSFA TSSFACQDIL GGRFLHQPKF EMNDWYKNVK VEDGVERSPQ LAIPFSNEQL  300
QPKSVFTLYH AKKQCQPLHD EGQPAVTTSR INENIISSLQ DMRGSDFVSP SLFHTTSTGS  360
EVLHVLDTSC TIHGLSGISN SSNALSLLSS QSRDSSNHST VFRAAHPLIS PSNNSRYSLT  420
QASKEVLGLS PQDSAGRMSN TFNSSGVNSA EGGLDQILFP SNTCGVNGII QGPNFVNHKD  480
QLSCEDGPTI DLLQLSSQLQ RVEHQRLSMQ VKQGSNTFPG LRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29157237484squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019230968.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A314KID50.0A0A314KID5_NICAT; Squamosa promoter-binding-like protein 6
STRINGXP_009758722.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-44SBP family protein