PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02983g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 907aa    MW: 100225 Da    PI: 4.566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02983g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52281561128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lp+G+rF+Ptdeelv++yL+ k++g + e+ +vi+evdi+k+ePwdLp +  v+++++ew+fF+++d+ky++g+r nrat++gyW
  Niben101Scf02983g01003.1  28 LPVGYRFRPTDEELVNHYLRLKINGADSEV-SVIREVDICKLEPWDLPdMsVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYW 111
                               799************************999.99**************96347788999*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               katgkd+++ +kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  Niben101Scf02983g01003.1 112 KATGKDRNIATKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 156
                               *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-5822179IPR003441NAC domain
PROSITE profilePS5100555.7528179IPR003441NAC domain
PfamPF023652.0E-2629155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 907 aa     Download sequence    Send to blast
MMAVLPGDNV IAVLPVDRQM GIPPLNTLPV GYRFRPTDEE LVNHYLRLKI NGADSEVSVI  60
REVDICKLEP WDLPDMSVVE SNDNEWFFFC PKDRKYQNGQ RLNRATERGY WKATGKDRNI  120
ATKKGAKIGM KKTLVYYIGR APEGKRTHWV IHEYRATDKS LDGSHPGQGA FVLCRLFKKN  180
DLKQDEHFES SNLDDTELNA TVAKSPTEGD LSEAATPLAV IQPFGDSDKS YAAKLPKGEM  240
YGKQLPIESH SNSCIADDTE DQMLDITSIP PDMELEKALG NFRDPSMQPL DWKIFSPLHS  300
QLQVELGSSY LQTPMNNGTG AYQKDVQFQY GTNAFDINEF LDSVIINSDE FSCEDSGQEL  360
ASHRFNTQFC SVPGAPIKDS GSCSESEAEV TQRLVEPDFF EPEVLLGNFD RENAVKREVN  420
SIGAAVQEAR GSAPYVSHDH AMGNLDFFQH SYPGQNVYPG QNVYPAGYGA IQVPNFPGVE  480
QSGGYSNVVS SDSGSGTGIK LRPRQMQNQS DDRQFRTQGT ANRRIRLQVK LQVGPVESRS  540
HTASSQGPES HQAVTEAEKA SDEHSSSTSD ESRDTTCGEN GVSGEADDLS TPVKDAYDSP  600
VQDTVDVSLK TTTKLSSSSR LYMSMVLVVV GVLVGAFVLC RLFKKNDLKQ DEHFESSNLD  660
DTELNATVAK SPTEGDLSEA ATPLAVIQPF GDSDKSYAAK LPKGEMYGKQ LPIESHSNSC  720
IADDTEDQML DITSIPPDME LEKALGNFRD PSMQPLDWKI FSPLHSQLQV ELGSSYLQTP  780
MNNGTGAYQK DVQFQYGTNA FDINEFLDSV IINSDEFSCV DSGQELASHR FNTQFCSVPG  840
APIKDSGSCS ESEAEVTQRL TSLSPRCCWA TSIERMQLKE RLTPLGPQCK RLVEVHLMLA  900
MIMLWGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-442718416170NO APICAL MERISTEM PROTEIN
1ut4_B9e-442718416170NO APICAL MERISTEM PROTEIN
1ut7_A9e-442718416170NO APICAL MERISTEM PROTEIN
1ut7_B9e-442718416170NO APICAL MERISTEM PROTEIN
3swm_A1e-432718419173NAC domain-containing protein 19
3swm_B1e-432718419173NAC domain-containing protein 19
3swm_C1e-432718419173NAC domain-containing protein 19
3swm_D1e-432718419173NAC domain-containing protein 19
3swp_A1e-432718419173NAC domain-containing protein 19
3swp_B1e-432718419173NAC domain-containing protein 19
3swp_C1e-432718419173NAC domain-containing protein 19
3swp_D1e-432718419173NAC domain-containing protein 19
4dul_A9e-442718416170NAC domain-containing protein 19
4dul_B9e-442718416170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019226326.10.0PREDICTED: NAC domain-containing protein 62-like
TrEMBLA0A314KRX50.0A0A314KRX5_NICAT; Nac domain-containing protein 62
STRINGXP_009759914.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.18e-84NAC domain containing protein 62