PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02887g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 255aa    MW: 28904.6 Da    PI: 8.5792
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02887g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.42.2e-19187221135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf02887g00002.1 187 CQHCGVDKTPQWRAGPIGPKTLCNACGVRYKSGRL 221
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.952181217IPR000679Zinc finger, GATA-type
SMARTSM004014.0E-17181235IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-15183244No hitNo description
Gene3DG3DSA:3.30.50.101.3E-14184219IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.01E-16186243No hitNo description
PROSITE patternPS003440187212IPR000679Zinc finger, GATA-type
PfamPF003202.9E-17187221IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVEALDSSTC FMVDDDILNF SLDEEKHPSI SSSSSLDSSN NISFLPDDHS RSFHEYVEEE  60
LEWLSNKDAF PAVEFDIFSE NIPNVIFDHH SPVSVLENGS SINTNNNSCN VNDKESAFMI  120
GCGSLQVPVN YPVRARGKRR RRISFADLTN QRCVWGRKLK IKKNKQDWEL FSLPMTKAKR  180
ASIGRRCQHC GVDKTPQWRA GPIGPKTLCN ACGVRYKSGR LLPEYRPANS PTFSANIHSN  240
SHRKVLEMRK QRIGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137142KRRRRI
2138159RRRRISFADLTNQRCVWGRKLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758423.11e-155PREDICTED: GATA transcription factor 1
SwissprotQ8LAU91e-43GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A0V0HUC21e-104A0A0V0HUC2_SOLCH; Putative GATA transcription factor 1-like
STRINGSolyc05g053500.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.15e-44GATA transcription factor 1