PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02868g02003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 342aa    MW: 37957.4 Da    PI: 5.8834
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02868g02003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.81.4e-051143436
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                              + C+ ++   ++ fC+ ++ +lC  C  ++H  
  Niben101Scf02868g02003.1 11 KLCDSCKTTSATVFCRADSAFLCIGCDCKIHAA 43
                              68******99*****************999954 PP

2zf-B_box25.43e-085395339
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                               ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  Niben101Scf02868g02003.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHER 95
                              689*****************************65777777776 PP

3CCT69.96.6e-24278321144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Niben101Scf02868g02003.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-7855IPR000315B-box-type zinc finger
PROSITE profilePS501199.926855IPR000315B-box-type zinc finger
CDDcd000211.06E-51255No hitNo description
PROSITE profilePS5011910.5945198IPR000315B-box-type zinc finger
PfamPF006432.0E-65397IPR000315B-box-type zinc finger
CDDcd000216.24E-95498No hitNo description
SMARTSM003361.6E-105698IPR000315B-box-type zinc finger
PfamPF062035.1E-18278320IPR010402CCT domain
PROSITE profilePS5101716.787278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSSENWSLTA KLCDSCKTTS ATVFCRADSA FLCIGCDCKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERFPVVP FYDTAVAKSH GGVNDDEKYF  120
DSHENNPQPE EEAEAASWIL PTPKEGTDNQ YKSADYLFND MDSYLDMDTM SCDQKPNNIL  180
QLYQQYCSDG VVPVQNKNES SHLQGPVVNG FPTYEMDFIG SKPYLYNFNS QSISQSVSSS  240
SMEVGVVPEH SATADVSNSL VMNSSGDTVP NPVSGLDREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TEIEVDSLLA AADASYGVVP SF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019262225.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-102COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A314LAY20.0A0A314LAY2_NICAT; Zinc finger protein constans-like 4
STRINGXP_009758697.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-100CONSTANS-like 4