PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02761g04008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 196aa    MW: 22170.6 Da    PI: 10.1575
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02761g04008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-18107141135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf02761g04008.1 107 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 141
                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.0E-701192IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-15101151IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.477101137IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15102165No hitNo description
Gene3DG3DSA:3.30.50.106.0E-14105139IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.36E-12106153No hitNo description
PROSITE patternPS003440107132IPR000679Zinc finger, GATA-type
PfamPF003204.5E-16107141IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
SDDVAELEWL SNFVEDSSNN YPSNSLTGTI NLNSSNTSFH SKSRSKRSRA TTANTNWASS  60
LQQAHQKPTD EKPNQSPQYN NNNNTMKPKK ESSRGRSCEM SDIPRKCTHC ASEKTPQWRT  120
GPLGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFVLTQHSN SHRKVMELRR QKEVQQQSQQ  180
GMYGHHFQTF IVLVII
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591827.11e-128PREDICTED: GATA transcription factor 4-like
RefseqXP_016439221.11e-128PREDICTED: GATA transcription factor 4-like
SwissprotO497418e-66GATA2_ARATH; GATA transcription factor 2
TrEMBLK4CYY04e-79K4CYY0_SOLLC; Uncharacterized protein
STRINGSolyc10g018560.1.11e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.13e-58GATA transcription factor 2