PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02750g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 69aa    MW: 8190.54 Da    PI: 5.1905
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02750g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26026.42e-083435999
                    DUF260 59 sslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                              +sl+ eA++r ++PvyG++++ +kl+  +e+ ++el+ +++
  Niben101Scf02750g02001.1  3 ESLFLEAKIRKENPVYGCLAIERKLKLAIEENEKELEIVQK 43
                              79**********************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.8E-6342IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MSESLFLEAK IRKENPVYGC LAIERKLKLA IEENEKELEI VQKTNAFYKE MAKSQMQKYK  60
PALVEFEEY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019225769.11e-29PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A314KT002e-28A0A314KT00_NICAT; Lob domain-containing protein 27
STRINGXP_009629106.11e-26(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752