PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02459g02011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 287aa    MW: 32654 Da    PI: 7.4029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02459g02011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.1e-52161451129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeek...ewyfFskrdkkyatgkrknratksgy 82 
                               +ppGfrFhPtdeel+++yLkkk++ +k+++ evi+e+d++k+ePw+L++++k +++   ewyfFs++d+ky+tg+r+nrat++g+
  Niben101Scf02459g02011.1  16 VPPGFRFHPTDEELLHYYLKKKLSFHKFDM-EVIREIDLNKIEPWELQERCKIGSTpqsEWYFFSHKDRKYPTGSRTNRATNAGF 99 
                               69****************************.99**************964444333335************************** PP

                       NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               Wkatg+dk + +   +++g++ktLvfy+grap+g++tdW+mheyrle
  Niben101Scf02459g02011.1 100 WKATGRDKCIRN-MLKKIGTRKTLVFYRGRAPHGQRTDWIMHEYRLE 145
                               ***********9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5315153IPR003441NAC domain
PROSITE profilePS5100551.71716162IPR003441NAC domain
PfamPF023653.8E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MASSGGGGGG GGGGGVPPGF RFHPTDEELL HYYLKKKLSF HKFDMEVIRE IDLNKIEPWE  60
LQERCKIGST PQSEWYFFSH KDRKYPTGSR TNRATNAGFW KATGRDKCIR NMLKKIGTRK  120
TLVFYRGRAP HGQRTDWIMH EYRLEDSDEN SSGVASSNLL NNTSIHQPRT TFTHKESPYL  180
LQHSHDHSLN YSHIPTAVAA TFPQHDEYNS HNNHIQLAQN FMSLGYNHHP HDFSSGESGL  240
EVASSHQNMN NDQWGIINED ANVASSSINQ INNHLPLRGE MDFWNYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-461615217151NO APICAL MERISTEM PROTEIN
1ut4_B2e-461615217151NO APICAL MERISTEM PROTEIN
1ut7_A2e-461615217151NO APICAL MERISTEM PROTEIN
1ut7_B2e-461615217151NO APICAL MERISTEM PROTEIN
3swm_A2e-461615220154NAC domain-containing protein 19
3swm_B2e-461615220154NAC domain-containing protein 19
3swm_C2e-461615220154NAC domain-containing protein 19
3swm_D2e-461615220154NAC domain-containing protein 19
3swp_A2e-461615220154NAC domain-containing protein 19
3swp_B2e-461615220154NAC domain-containing protein 19
3swp_C2e-461615220154NAC domain-containing protein 19
3swp_D2e-461615220154NAC domain-containing protein 19
4dul_A2e-461615217151NAC domain-containing protein 19
4dul_B2e-461615217151NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629334.11e-172PREDICTED: protein BEARSKIN2-like
SwissprotQ9SV874e-96BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A1U7VIZ21e-160A0A1U7VIZ2_NICSY; protein BEARSKIN1-like
STRINGXP_009629334.11e-172(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.15e-84NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]