PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02439g00023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 303aa    MW: 34788.1 Da    PI: 4.3763
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02439g00023.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.3e-1872125356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k++++ ++q++ Le+ Fe ++++  e++ +LA++lgL+ rq+ +WFqNrRa++k
  Niben101Scf02439g00023.1  72 KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYK 125
                               45578899*********************************************9 PP

2HD-ZIP_I/II118.63.5e-3871156186
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               ekkrrl  +qv++LE+sFe ++kLeperKv+la+eLglqprq+a+WFqnrRAR+ktk lEkdy++Lk+++d+lk++ ++L ke+ 
  Niben101Scf02439g00023.1  71 EKKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYKTKLLEKDYDVLKASFDKLKDDYDTLFKENY 155
                               69******************************************************************************99986 PP

               HD-ZIP_I/II  86 e 86 
                               +
  Niben101Scf02439g00023.1 156 D 156
                               5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1857126IPR009057Homeodomain-like
PROSITE profilePS5007117.10367127IPR001356Homeobox domain
SMARTSM003894.6E-1870131IPR001356Homeobox domain
PfamPF000461.9E-1572125IPR001356Homeobox domain
CDDcd000869.86E-1772127No hitNo description
Gene3DG3DSA:1.10.10.602.2E-1875134IPR009057Homeodomain-like
PRINTSPR000315.6E-698107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000315.6E-6107123IPR000047Helix-turn-helix motif
PfamPF021831.1E-8128154IPR003106Leucine zipper, homeobox-associated
PfamPF021831.8E-8155182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEARRVNEDS NMTTTNTVLP SEVLHNLWMS NSSPSFHDGR GEISKERSFF SPVDKEETSN  60
DDYDSCFHQP EKKRRLLPNQ VQFLEKSFEV DNKLEPERKV QLAQELGLQP RQIAIWFQNR  120
RARYKTKLLE KDYDVLKASF DKLKDDYDTL FKENYDVLKA SFDKLKDDYD TLVKENENLR  180
NEKGKENSEQ NEPIISQVDA EEAQKASPNV VTSEGPSIQK VVCKQEDASS TKSDVMDSDS  240
PHYTDGNHSS NAFEPEPSDF SQDEDDNLSK SFLCFPEIGD QIQANSCNLG FQIEDQPFAT  300
VNL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610614.11e-177PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_016442143.11e-177PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0V0I6661e-152A0A0V0I666_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000454711e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-40homeobox 1