PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02413g02012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 441aa    MW: 50340.1 Da    PI: 5.8827
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02413g02012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.21.3e-43591862128
                       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                               ppG+rF+Ptd+elv++yLk+k+++ +l   + + e++iyk++P+ + +  k ++eekewy  ++rd+ky++g+r+nra+ +gyWk
  Niben101Scf02413g02012.1  59 PPGYRFNPTDSELVTHYLKRKLDNLPLYP-NRMYEINIYKYNPELIAAhvKPTTEEKEWYVLTPRDRKYRNGNRPNRAAGDGYWK 142
                               9*************************887.67**************85235556889**************************** PP

                       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               atg dk+++++k+ l+glkk+Lv+y g+ pkgekt+W+mheyr+
  Niben101Scf02413g02012.1 143 ATGADKKIKDNKNVLIGLKKSLVYYIGKPPKGEKTNWIMHEYRV 186
                               **********9*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-5354213IPR003441NAC domain
PROSITE profilePS5100551.28558213IPR003441NAC domain
PfamPF023654.4E-2559186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MENHHSSSSP TNNANISKGK LTDQIPITEL PVTAVLSNNN KNGEITSAEE IDAYINNFPP  60
GYRFNPTDSE LVTHYLKRKL DNLPLYPNRM YEINIYKYNP ELIAAHVKPT TEEKEWYVLT  120
PRDRKYRNGN RPNRAAGDGY WKATGADKKI KDNKNVLIGL KKSLVYYIGK PPKGEKTNWI  180
MHEYRVPDIP NLAERDINVW KLDEWVLCRI YKKSNIDNTM VTQRKRIRDA YETKTGRGNS  240
NDSVQDFNDD GQFRESSDGN LSNEFANITF ESTSQDSTRH DSIQDTLYSN SIVPTFHPQV  300
PSRFGIFPKS CVPEFCDMPW STTSGYDYQS IVTNDKFHYA PSPMKIEPIS SVMANNNFMG  360
QDDNMKSKEF GDIPCFSSCV GGYLGQDNEY MGLEKLDSGE FIDQYLVNCE MVNSTMYLPE  420
YNLKNLVHGE SSSQPNTISG K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-485721516167NO APICAL MERISTEM PROTEIN
1ut4_B4e-485721516167NO APICAL MERISTEM PROTEIN
1ut7_A4e-485721516167NO APICAL MERISTEM PROTEIN
1ut7_B4e-485721516167NO APICAL MERISTEM PROTEIN
4dul_A4e-485721516167NAC domain-containing protein 19
4dul_B4e-485721516167NAC domain-containing protein 19
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793862.10.0PREDICTED: NAC domain-containing protein 102-like
TrEMBLA0A314KWZ20.0A0A314KWZ2_NICAT; Nac transcription factor 25
STRINGXP_009793862.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139361213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-54NAC domain containing protein 25