PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02380g01006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 107aa    MW: 11892.8 Da    PI: 8.8097
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02380g01006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.7e-40895188
                    DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87
                              +Ca+Ck+lrr+CakdC++apyfp+++p+kf +vhk+FGasn++k+l+++p ++r da+ss+vyeA+ r+rdPvyG++g i+ lq+ +
  Niben101Scf02380g01006.1  8 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFGIVHKVFGASNISKMLQEVPVNKRADAVSSIVYEANTRMRDPVYGCLGAISYLQKYV 94
                              7***********************************************************************************988 PP

                    DUF260 88 e 88
                              e
  Niben101Scf02380g01006.1 95 E 95
                              6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1517107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-39895IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MGATGNSPCA SCKLLRRRCA KDCIFAPYFP SDDPHKFGIV HKVFGASNIS KMLQEVPVNK  60
RADAVSSIVY EANTRMRDPV YGCLGAISYL QKYVEIFLCS FPSTTYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-39594897LOB family transfactor Ramosa2.1
5ly0_B2e-39594897LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019229583.11e-61PREDICTED: LOB domain-containing protein 12-like isoform X2
SwissprotQ8LBW33e-55LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1S3X5C49e-58A0A1S3X5C4_TOBAC; LOB domain-containing protein 12-like
STRINGXP_009764881.11e-57(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-57LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]