PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02320g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 64aa    MW: 7112.23 Da    PI: 4.9391
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02320g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26047.17.1e-156554897
                    DUF260 48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                              ++p ++reda+ s+vyeA ar+rdP yG+vg+i++lq+++ +l++el+++
  Niben101Scf02320g00005.1  6 EIPVDNREDAVISMVYEATARLRDPAYGCVGIISALQKHVFHLQSELNEA 55
                              568899****************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.061159IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-14654IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MLRVLEIPVD NREDAVISMV YEATARLRDP AYGCVGIISA LQKHVFHLQS ELNEALGEAM  60
SLRA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631247.24e-32PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-12LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1S4CR381e-30A0A1S4CR38_TOBAC; LOB domain-containing protein 25-like isoform X2
TrEMBLA0A1S4CRC51e-30A0A1S4CRC5_TOBAC; LOB domain-containing protein 25-like isoform X1
STRINGSolyc06g082770.2.16e-30(Solanum lycopersicum)
STRINGPGSC0003DMT4000711326e-30(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA131471419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.16e-16LOB domain-containing protein 25