PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02243g03001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 252aa    MW: 29048.3 Da    PI: 4.8892
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02243g03001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM111.59e-35111261116
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrF P+deelv +yL kk+++++ +l+ ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWka
  Niben101Scf02243g03001.1  11 LPPGFRFYPSDEELVFHYLFKKIANED-SLKGTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATTSGYWKA 94 
                               79**********************999.45478***************87788899***************************** PP

                       NAM  86 tgkdkevlskkgel.vglkktLvfykgrapkg 116
                               tgkd++vl+ ++++        vf+k++a+++
  Niben101Scf02243g03001.1  95 TGKDRTVLDPRTRTtEDWVLCRVFHKAKAENS 126
                               ********974443233344447777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-409120IPR003441NAC domain
PROSITE profilePS5100534.8111163IPR003441NAC domain
PfamPF023655.5E-1612105IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MMGLRDIGAT LPPGFRFYPS DEELVFHYLF KKIANEDSLK GTLVEIDLHT CEPWQLPEVA  60
KLNSSEWYFF SFRDRKYATG FRTNRATTSG YWKATGKDRT VLDPRTRTTE DWVLCRVFHK  120
AKAENSSNNN ILSPQNAYEV GVVSSPNNNN MDQSHALPYD CYRPNMAAAA VSQRPFHQRQ  180
KLFDLMEADN NQTIYPQLSQ EMTKAPSNDQ IAEDEYGFLL DMNFEDPSLQ DRGVHSSIED  240
MRFDNDNSLV FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-301013216136NO APICAL MERISTEM PROTEIN
1ut4_B2e-301013216136NO APICAL MERISTEM PROTEIN
1ut7_A2e-301013216136NO APICAL MERISTEM PROTEIN
1ut7_B2e-301013216136NO APICAL MERISTEM PROTEIN
3swm_A3e-301013219139NAC domain-containing protein 19
3swm_B3e-301013219139NAC domain-containing protein 19
3swm_C3e-301013219139NAC domain-containing protein 19
3swm_D3e-301013219139NAC domain-containing protein 19
3swp_A3e-301013219139NAC domain-containing protein 19
3swp_B3e-301013219139NAC domain-containing protein 19
3swp_C3e-301013219139NAC domain-containing protein 19
3swp_D3e-301013219139NAC domain-containing protein 19
4dul_A2e-301013216136NAC domain-containing protein 19
4dul_B2e-301013216136NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800923.11e-168PREDICTED: NAC domain-containing protein 21/22-like
RefseqXP_016469611.11e-168PREDICTED: NAC domain-containing protein 21/22-like
RefseqXP_019231599.11e-168PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A1S3ZZ691e-167A0A1S3ZZ69_TOBAC; NAC domain-containing protein 21/22-like
TrEMBLA0A1U7YCR11e-167A0A1U7YCR1_NICSY; NAC domain-containing protein 21/22-like
TrEMBLA0A314KGY11e-167A0A314KGY1_NICAT; Nac domain-containing protein 2122
STRINGXP_009800923.11e-168(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.22e-66NAC domain containing protein 74