PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02213g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 910aa    MW: 101797 Da    PI: 7.1122
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02213g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.22.5e-092663272082
                  trihelix  20 rlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82 
                               + +rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++ + e+  + +yf
  Niben101Scf02213g03002.1 266 QQGRGKTRADKDREVADFLNRHGVNRDAKTAGTKWDNMLGEFRKVYEWERGAEREQ-GSKSYF 327
                               445788999999**************************************974444.355666 PP

Sequence ? help Back to Top
Protein Sequence    Length: 910 aa     Download sequence    Send to blast
MDENKGEITK KQAQQQHLSN SPDDSNQDSP DNTIPQQQPP QTVISGAPYI SSSLYNIPGG  60
AATTSVSFEQ QQQQQQFEVV NPKRPRYTAS QWKFIPSSSS SQQQQQKPAI QVNILSTESS  120
PISPSPQAAA TNPQTQAASS SSSQQQQQKP ASQVNILSTE SSPISPSPQA AATNPQTQAA  180
SSSDTTSSPS HSPRPSASGQ ETSKAEAGEQ VHQQHQQFRK GKYVSPVWKP NEMLWLARAW  240
KIQYQGGSSE LHLEGSQEMS TAAGVQQGRG KTRADKDREV ADFLNRHGVN RDAKTAGTKW  300
DNMLGEFRKV YEWERGAERE QGSKSYFRLS PYERKMNRLP ASFDEEVFEE LSQFMGPRMR  360
SPQSRGGVGV GSQATIVVSL SDTVTRSLPP PPPFREDDLP LSARAKQLAI PISGTEALLH  420
GTRGGFLGYD TTTTSLDIGG PSSSTSSKEL RRIGKIRMIW EESVSLWAEE GEHHRGRVKL  480
QGTSFLNADE IAFLDDSTVA CAMEAFEDGP MKGFSVDRFH SGVQLKVFGR RKSSSAAAPS  540
GPNERLQLPS SEFPIRSATP WEFQDPTEYY VGCLRSPPPT LPSLFELSWH LQQPPPEELR  600
FPIRRDVFKD LPQGKELFFT TSAELLDCRG ITYEVMSSIM RPNPSLSTAT DRDSYIGLWD  660
DCINRIISKF CSIEMVFVRK SNSSFSLAET VQDQWPNVTA FLRNFCLWRG EETGQLIEGQ  720
LDPSSSIVEK LLWTYMDLPY VLGYYAVGFI VTFCALSRSQ DRIIRTDLYT VDLSAPVERL  780
KALVPCWRIA GLLPLLADQC FHYMSNNGSN LKHLPYTDFE RIDLGNGNYV EMTPNTVVRY  840
FSSKRKWVAV KEIYDFLDHR IPHAEFVFRA SEKDLSLVVK ENGWQSKKYT IFLTTGSHMR  900
NLFLGHLKRI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775235.10.0PREDICTED: uncharacterized protein LOC104225161
TrEMBLA0A1U7WLU20.0A0A1U7WLU2_NICSY; uncharacterized protein LOC104225161
STRINGXP_009775235.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129361416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.19e-09Trihelix family protein