PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02207g03006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 161aa    MW: 17898.2 Da    PI: 7.7005
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02207g03006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.7e-4410108199
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+++l+yeAear+rdPvyG+vg i+ lq+
  Niben101Scf02207g03006.1  10 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNTLAYEAEARVRDPVYGCVGAITFLQR 94 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallke 99 
                               q+e+l++el+++++
  Niben101Scf02207g03006.1  95 QVERLRKELDAANA 108
                               *********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.559110IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MASSSCYNSP CAACKFLRRK CLPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNTL AYEAEARVRD PVYGCVGAIT FLQRQVERLR KELDAANADL IRYCSCNDAS  120
APLVRGYELG GFHQTHNFPF PYPPSWNDQS PSGDQGRGGN I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-6481139114LOB family transfactor Ramosa2.1
5ly0_B4e-6481139114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778337.11e-112PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_009778338.11e-112PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_016510977.11e-112PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_019248966.11e-112PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML49e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1J6IB201e-111A0A1J6IB20_NICAT; Protein lateral organ boundaries
TrEMBLA0A1S4DC181e-111A0A1S4DC18_TOBAC; protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A1U7WEE41e-111A0A1U7WEE4_NICSY; protein LATERAL ORGAN BOUNDARIES-like
STRINGXP_009778337.11e-111(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-73LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]