PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02085g15011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 261aa    MW: 31342.5 Da    PI: 5.431
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02085g15011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.55.7e-2635117186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               +W+ qe+++ + +r em++++ ++k++k lWe +++km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l
  Niben101Scf02085g15011.1  35 QWSIQETKEFLMIRGEMDQNFMETKRNKLLWEVIAAKMKEKGYNRSAEQCKCKWKNLVTRYKGCETMEAEA--L-RQQFPFYNEL 116
                               7********************************************************************95..3.4589*****9 PP

                  trihelix  86 e 86 
                               +
  Niben101Scf02085g15011.1 117 Q 117
                               8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00853294IPR001005SANT/Myb domain
CDDcd122034.11E-243499No hitNo description
PfamPF138376.9E-2235119No hitNo description
PROSITE profilePS500907.3643692IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEGQPNLYHQ HQFVSQQSLL NIDTSGVGGG DRFPQWSIQE TKEFLMIRGE MDQNFMETKR  60
NKLLWEVIAA KMKEKGYNRS AEQCKCKWKN LVTRYKGCET MEAEALRQQF PFYNELQAIF  120
MERMLRMEAE EEENDVDSEE EKGSNKKKRK LKGNTSSSST NVASGTLEGN LKEILDEFMN  180
KQMEMEMQWQ KEYERREEER KIKEMEWRQK MEAVQNERLM MEKRWREREE QWKMREEGRA  240
EKRDALITAL LNKLRSEDTS N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145150KKKRKL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269|PubMed:15310827}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269|PubMed:15310827}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464713.11e-153PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804507e-64TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A1S3ZKD61e-151A0A1S3ZKD6_TOBAC; trihelix transcription factor GT-3b-like
STRINGXP_009768581.11e-152(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.19e-51Trihelix family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]