PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02083g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 806aa    MW: 90847.1 Da    PI: 7.6613
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02083g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.22.5e-0935952182
                  trihelix 21 lrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82
                               +rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++ + e+  + +yf
  Niben101Scf02083g00003.1 35 QGRGKTRADKDREVADFLNRHGVNRDAKTAGTKWDNMLGEFRKVYEWERGAEREQ-GSKSYF 95
                              45788999999**************************************974444.355666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001804.38E-14654791No hitNo description
Gene3DG3DSA:1.10.510.103.6E-5657756No hitNo description
SuperFamilySSF561122.38E-15658797IPR011009Protein kinase-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MLWLARAWKI QYQGGSSELH LEGSQEMSTG AGVQQGRGKT RADKDREVAD FLNRHGVNRD  60
AKTAGTKWDN MLGEFRKVYE WERGAEREQG SKSYFRLSPY ERKMNRLPAS FDEEVFEELT  120
QFMGPRMRSP QTRGGVGVGT QANIIVSLSD TVTKSLPPPP PCREDDRPLS ARAKQLAIPI  180
SGTEALLHGT RGGFLGYDTT TATSSDIGGP SSSASSKELR RIGKIRMIWE ESVSLWAEEG  240
EHHRGRVKLQ GTSFLNADEI AFLDDSTVAC TLEAFEDGPM KGFSVDRFLS GVQLKVFGRR  300
KSSSSPAPSG PNERLQLPSS EFPIRSTTPW EFQDPTEYYV GCLRFPPPAL PSLFELSWHL  360
QQPPPEELRF PLRRDVFKDL PQGKELFFTT STELLDCRGI TYDVVSSIMR PNPSPSTATD  420
RDSYIGLWDD SINRIISKFC SIEMVFVRKS NSSFSLAETV QDQWPNVTAF LRNFCLWRGE  480
ETGQLREGQL DPSSSIVEKL LWTYMDLPYV LGYYAVGFVV TFCALSRSQD RIIRTDLYTV  540
DLSTPVERLK ALVPCWRIAG LLPLLADRCF HYMSSNGSNL KHLPYTDFER IDLGNGNYVE  600
MTPNTVVRYF SSKRKWMAVK EIYDFLDHRI PHAEFVFRAS EKDLALAFKP RGCKFKPANC  660
DQLIEALKQI TKALVALHDL SFMHRGLGWD KVMRRSDREN EWFITGFDEA VSSPQLYPYG  720
GAAAAGTASG RHPPEMVRNY HNVKVDVWGI GQLVKSCGLV GVPKLLRELQ NRCLDQNPEQ  780
RPTAADCYRH LLQLQSSMSA AAAGGY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775235.10.0PREDICTED: uncharacterized protein LOC104225161
TrEMBLA0A1U7WLU20.0A0A1U7WLU2_NICSY; uncharacterized protein LOC104225161
STRINGXP_009775235.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129361416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.13e-08Trihelix family protein