PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02045g02010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 172aa    MW: 18849.3 Da    PI: 8.1423
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02045g02010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601452.1e-45131121100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+Ca+dCv++pyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqq
  Niben101Scf02045g02010.1  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQ 97 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+++la +++e
  Niben101Scf02045g02010.1  98 QIDHLQTQLAIAQAE 112
                               **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8812113IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESGRKQSA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID HLQTQLAIAQ AEVVHMRMRQ  120
FSSMSRGGGT AGNSPENVSP SSRHTQTQPT MSLFTMDMVV DHANVGESLW SC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-5091147112LOB family transfactor Ramosa2.1
5ly0_B7e-5091147112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016493640.11e-125PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE91e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1S4BXL91e-123A0A1S4BXL9_TOBAC; LOB domain-containing protein 4-like
STRINGXP_009603165.11e-124(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-80LOB domain-containing protein 4