PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01998g10005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 272aa    MW: 29918.9 Da    PI: 9.8412
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01998g10005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.13.1e-38561551100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++rr+Ca+dC+lapyfpae++k+f n+hklFG++n+lk+l+++p+ +++da+++l++eA++ a+dPv G++++i++l +
  Niben101Scf01998g10005.1  56 ACAACKYQRRRCAPDCPLAPYFPAERQKDFLNAHKLFGVTNILKVLRNVPPFQKDDAVKALIFEANIHADDPVGGCHRLIQNLYR 140
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q++  +a+l+l+ ++
  Niben101Scf01998g10005.1 141 QINLYQAQLKLVYHQ 155
                               **********99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.61355156IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-3756152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTNVVTNTRN ISPTPASATT SAVTTSTGVR SNPKNITRVA SRGGGSGGSG ANGSQACAAC  60
KYQRRRCAPD CPLAPYFPAE RQKDFLNAHK LFGVTNILKV LRNVPPFQKD DAVKALIFEA  120
NIHADDPVGG CHRLIQNLYR QINLYQAQLK LVYHQIVWVQ EAAIQEQQNF SMMTSVRGTN  180
SNLNFDMRPL HGVHGFNRYN SICLGEAGSS YQIVKGKGVE RFNNVEEFAV KTMMTHSNAK  240
QPLVESEDIK QYCGNIHNFK GKGVATELRS VT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-27481577112LOB family transfactor Ramosa2.1
5ly0_B9e-27481577112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607074.11e-153PREDICTED: LOB domain-containing protein 7-like
TrEMBLA0A1S3XSW61e-150A0A1S3XSW6_TOBAC; LOB domain-containing protein 7-like
STRINGXP_009785905.11e-150(Nicotiana sylvestris)
STRINGXP_009607074.11e-152(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA142941012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-34LOB domain-containing protein 22