PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01903g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 128aa    MW: 14451.4 Da    PI: 10.545
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01903g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP52.22.3e-166095237
                       TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqd 37
                              a+k+++++++hTkv+gR+RR+R++a+ca r+F+L+ 
  Niben101Scf01903g00004.1 60 APKRSSNKDRHTKVEGRGRRIRMPALCATRIFQLTL 95
                              789*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.0E-126594IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MDPKGSKQPQ EEISNFLSHP NPKNINTNIS SNMGENNLVE INDFQIENSD KDETKKQQLA  60
PKRSSNKDRH TKVEGRGRRI RMPALCATRI FQLTLMGCSV NIFVLKLGVI RFLKNQGTRQ  120
SDGLNNGI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009757309.12e-55PREDICTED: transcription factor TCP20 isoform X1
RefseqXP_009757310.12e-55PREDICTED: transcription factor TCP20 isoform X2
TrEMBLA0A1U7V4Z94e-54A0A1U7V4Z9_NICSY; transcription factor TCP20 isoform X1
TrEMBLA0A1U7V6F63e-54A0A1U7V6F6_NICSY; transcription factor TCP20 isoform X2
STRINGXP_009757309.17e-55(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-23TCP family protein