PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01796g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 302aa    MW: 33154.2 Da    PI: 6.7478
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01796g01001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.92e-29168224158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep+YVNaKQy+rIl+RRq+Rak+e e+k  +k+rkpylheSRh+hAlrR+R+sgGrF
  Niben101Scf01796g01001.1 168 QEPVYVNAKQYRRILQRRQSRAKAELERKQ-IKARKPYLHESRHQHALRRARASGGRF 224
                               69*************************999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.5E-32166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.998167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-24169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.8E-23170192IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.8E-23201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MPSNTKSTNR EESNAYNGPR SAVYSEPWWN SAGYNPVSPG LMRGTASDSS SLEQSMDGQS  60
QSDGGINEED DDAPEKSQSV VPFHADGSYG QADQNFQPVA STIPPKLDGT LTQTQQLELV  120
GHSIACAPNP YVDPYYGGMM TAFGQPLVPP HVLDMHYARM PLPHEMAQEP VYVNAKQYRR  180
ILQRRQSRAK AELERKQIKA RKPYLHESRH QHALRRARAS GGRFAKKTDA DTSKGTGSVS  240
SSGSELLQFN AADVQNRHEN GMLAELQHSY SNGSSYGNQS SFQEAKDEYH SAESREGGSS  300
GK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-17168232266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019251747.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLA0A1J6I1Z60.0A0A1J6I1Z6_NICAT; Nuclear transcription factor y subunit a-1
STRINGXP_009767513.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-57nuclear factor Y, subunit A1