PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01635g05017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 306aa    MW: 33847.9 Da    PI: 6.935
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01635g05017.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.26.1e-07144542
                  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                              +C+ +e+  ++  C+ +   lC  C   +H+       H+++p+
  Niben101Scf01635g05017.1  1 MCEVCEQVAASVTCKADAAALCVACDRDIHSAnplaqrHERIPV 44
                              5******99*********************66899999998885 PP

2CCT70.25.1e-24232275144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Niben101Scf01635g05017.1 232 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRN 275
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.5E-8144IPR000315B-box-type zinc finger
CDDcd000212.71E-9144No hitNo description
PROSITE profilePS5011910.651144IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638232274IPR010402CCT domain
PfamPF062036.0E-18232274IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MCEVCEQVAA SVTCKADAAA LCVACDRDIH SANPLAQRHE RIPVVPFYDP VESVVKSTAA  60
TLVSIYNSNS TTTTTTTTTA VAPDFSKVTA CLGHHEEDYN SDPWISPNTM TTKLPVNTME  120
MKPMDFLFSD SDNILDFDYS VSIDTNSQPI YNSANDSVVP VQSTIKPLPF QHQEKHFEID  180
FTQSHIKSYT TPSLSHNGSS NAEISYPFVR SVDSNIEMGS SAQAEKLIGL NREARVLRYR  240
EKKKNRKFEK TIRYASRKAY AETRPRIKGR FAKRNDSAGA GVDIDQSFSG AGFIVNGSRY  300
GVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019239974.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A1J6JVW20.0A0A1J6JVW2_NICAT; Zinc finger protein constans-like 5
STRINGXP_009799762.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.17e-76CONSTANS-like 5