PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01611g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 369aa    MW: 41277.9 Da    PI: 6.838
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01611g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11.1e-17261295135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf01611g01003.1 261 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 295
                               99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.1E-7513351IPR016679Transcription factor, GATA, plant
Gene3DG3DSA:3.30.50.105.1E-15254292IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.743255291IPR000679Zinc finger, GATA-type
SMARTSM004017.3E-18255305IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.71E-15256319No hitNo description
CDDcd002022.20E-14260307No hitNo description
PfamPF003201.4E-15261295IPR000679Zinc finger, GATA-type
PROSITE patternPS003440261286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
METPEFFQAS YYNSQFTPEK RLSDFKNGDH FVVEDLLDLP NDDGMVTDGT LDATVTVNSG  60
DSSVVDNSCN SSLSGSNHDP QLPVDNITGC RNFPDGQFSS EFSVPYDDLA ELEWLSNFVE  120
ESFSSNEMQK IQFIQGMKSR NDNETHQFIP DPNNNRASAA TNPIFNPDMS VPAKARSKRL  180
RMAPGNWASR LLVVSPNSPN NTTNLPMNTI TMQDMSSSSE SGIISSSGKK TVKSSTPKIK  240
KENTQHVPNN NMASNSEGRK CLHCATDKTP QWRTGPMGPK TLCNACGVRY KSGRLVPEYR  300
PAASPTFVLT KHSNSHRKVL EIRRQKEIVR THQHQQHQQL LPQNMMFDVS SADDYLIHQH  360
IGPDFRHLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631501.10.0PREDICTED: GATA transcription factor 9-like
RefseqXP_016491364.10.0PREDICTED: GATA transcription factor 9-like
TrEMBLK4CLM70.0K4CLM7_SOLLC; Uncharacterized protein
STRINGSolyc08g066510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-74GATA transcription factor 12