PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01531g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 439aa    MW: 48832.5 Da    PI: 8.7712
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01531g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.11.1e-4287163278
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q+
  Niben101Scf01531g00004.1  87 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQT 163
                               **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3481148IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.94984161IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-4085164IPR004333Transcription factor, SBP-box
PfamPF031108.3E-3287160IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MPSQDLLRKS LPNNQIRDAM SSKLGGQRSF VSIRVPHNAF SGEDEIITYI DLKLGSFKSP  60
NIIPNLSSTV TAKRNRAGGL SSHTPFCQVQ GCGKDLSSCK DYHKRHKVCE VHSKTAKVIV  120
NGIEQRFCQQ CSRFHLLAEF DDGKRSCRKR LAGHNERRRK PQTGLHSGRA GRLFQSYAGT  180
RFQGTPFATS YFICQDILGS GLLHQPKHDM HDWYKNLKIE HCSDYSPQLT MPFTNGHSQP  240
RPLFSTSYHT DKHPPALHDE GITAITRNKN NESSNSYLND NEGSDFVSRS LFHNTSIGSE  300
VLNVMDSAST FQGISNSGCA LSLLSSQSQD SSNYSSLAPN AHHLITPSSN ANYNVTQTSE  360
KFPGVNLKDS TSNASSIFIS AEDRMEQILR NNCGINGSIH GSDYVNTKNL LSCEDGPTID  420
LLQLSSQLHR VEHQRHFMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2981160584squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786196.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A1U7X9610.0A0A1U7X961_NICSY; squamosa promoter-binding-like protein 6
STRINGXP_009786196.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-47SBP family protein