PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01526g04017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 344aa    MW: 38991.4 Da    PI: 4.8959
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01526g04017.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94e-5361331128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lppGfrFhPtdeelv +yLk+k+++ ++el evi+ +d+yk++Pw+Lp k  + +++ ewyfF++rdkky++g+r+nratk gyW
  Niben101Scf01526g04017.1   6 LPPGFRFHPTDEELVGYYLKRKTDELEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWYFFCPRDKKYPNGSRTNRATKCGYW 89 
                               79****************************.99**************95344555788*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               katgkd++v++ k ++vg +ktLvfy+grap g +tdWvmheyrl
  Niben101Scf01526g04017.1  90 KATGKDRKVVC-KPAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                               ***********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-613156IPR003441NAC domain
PROSITE profilePS5100557.6046156IPR003441NAC domain
PfamPF023656.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGGTSLPPGF RFHPTDEELV GYYLKRKTDE LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWYFFCPR DKKYPNGSRT NRATKCGYWK ATGKDRKVVC KPAVVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCVDVSQG TPSFQGPYAL CRVIKRKDIS LKTSDVRGET ASKQVEWSSS  180
NKAFTSALTS NEPLVLSDDM PSTQTTYMCN DSNYSTPIGS PYQTTHIGES ESAMGTNAAN  240
LWISRNMILD PSEECLQGQS ISGNYPLYDF PSSTSWQPND QYDFTSSSSF PNFRGDVELS  300
GDLSGDGFAP PFSDDGSYME FYHNEDISYK GYNQSNLLGN PNLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-50516216171NO APICAL MERISTEM PROTEIN
1ut4_B3e-50516216171NO APICAL MERISTEM PROTEIN
1ut7_A3e-50516216171NO APICAL MERISTEM PROTEIN
1ut7_B3e-50516216171NO APICAL MERISTEM PROTEIN
4dul_A3e-50516216171NAC domain-containing protein 19
4dul_B3e-50516216171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019234708.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotO496977e-90NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A1J6L6070.0A0A1J6L607_NICAT; Nac domain-containing protein 86
STRINGXP_009802261.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.15e-80NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]