PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01450g05003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 356aa    MW: 42138.3 Da    PI: 7.1089
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01450g05003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.52.2e-48591851128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                               lppG+rF P+deel+ +yLkkkv +++l+  + ikev++yk+ P++L  +    +ekewyfF++rd+ky++g+r+nra+ +gyWk
  Niben101Scf01450g05003.1  59 LPPGYRFCPHDEELIIHYLKKKVMNERLTH-DKIKEVNLYKYSPQELSeNYSMLGEKEWYFFTPRDRKYPNGNRPNRAAGTGYWK 142
                               79*************************999.88**************8444445899**************************** PP

                       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               atg dk++++ ++ +vg +k Lvfy+g+ pkg kt+W+mhe+r+
  Niben101Scf01450g05003.1 143 ATGADKPIKH-NDIKVGFRKALVFYEGKPPKGDKTNWIMHEFRV 185
                               **********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5850211IPR003441NAC domain
PROSITE profilePS5100555.53459211IPR003441NAC domain
PfamPF023652.6E-2560185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEFDEQTKAH LKASQNPKIQ ELEKQKKVEN EKGLIIVKPN YNIISEISRV NYVDDSFVLP  60
PGYRFCPHDE ELIIHYLKKK VMNERLTHDK IKEVNLYKYS PQELSENYSM LGEKEWYFFT  120
PRDRKYPNGN RPNRAAGTGY WKATGADKPI KHNDIKVGFR KALVFYEGKP PKGDKTNWIM  180
HEFRVNESRR LKRHAEDMRL DEWVLCRIYK KVDKSFKNAR KEQEQDDASI SCSSIGKMEK  240
RDYEGTTDSY EIARQNLTLP HHYDITFDDP GFNMDYNKYS IDNFSHFGPR SNYGMPLQPS  300
FSPGNIFWDQ KGYQENCNLF PMHFDVNNFY QDSYDEIQSK NILDSVLDEN SSIYKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-585921120168NAC domain-containing protein 19
3swm_B2e-585921120168NAC domain-containing protein 19
3swm_C2e-585921120168NAC domain-containing protein 19
3swm_D2e-585921120168NAC domain-containing protein 19
3swp_A2e-585921120168NAC domain-containing protein 19
3swp_B2e-585921120168NAC domain-containing protein 19
3swp_C2e-585921120168NAC domain-containing protein 19
3swp_D2e-585921120168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019257792.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLA0A1J6HTC00.0A0A1J6HTC0_NICAT; Nac transcription factor nam-b1
STRINGXP_009759087.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-63NAC family protein