PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01429g01013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 292aa    MW: 32844 Da    PI: 10.0414
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01429g01013.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA804.3e-25130184258
                 CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                p++VNaKQy++Il+RR+ R k e e+k   k rkp+lh SRh hA+rRpRg gGrF
  Niben101Scf01429g01013.1 130 GPIFVNAKQYHGILRRRKFRVK-EMENKF-LKPRKPFLHLSRHLHAMRRPRGGGGRF 184
                               69******************98.556888.8*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-28127187IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115229.563128187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-19131153IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-21131184IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-19161184IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MHSIFTKRNE TATLWGSLVP HSVEPFGHMK SASMEKPSKG DITDFTTSSE SQSGDPKSSQ  60
KAEKLSDGVS MKSSNIDCQG HFEPLIYAKY PYGEKCFSTY GSQVSYNRVS ILKNFKGRVM  120
LPLNLTSDEG PIFVNAKQYH GILRRRKFRV KEMENKFLKP RKPFLHLSRH LHAMRRPRGG  180
GGRFLNTRKV NGSTNDGTTK TCNRKSEPNG SQNSEVLQSD HIGNFNSPNE TTSRMSCNSS  240
EVTSFYSREN LDTYTVHNPK PSIQAFFDMM NTVMPSKWGS AAADSCCNLN IW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A6e-15129185260HAPB protein
4g92_A6e-15129185260HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019254537.11e-166PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_019254538.11e-166PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_019254539.11e-166PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A1J6I0091e-165A0A1J6I009_NICAT; Nuclear transcription factor y subunit a-2
STRINGXP_009770986.11e-134(Nicotiana sylvestris)
STRINGXP_009613978.11e-133(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-40nuclear factor Y, subunit A10