PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01409g06005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 446aa    MW: 50083.7 Da    PI: 8.4747
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01409g06005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.5e-0585122439
                  zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htv 39 
                               + C+ ++   +  fC+ +++++C  C +  H++  H++
  Niben101Scf01409g06005.1  85 KPCEYCHLDAALVFCRVDNMFMCLVCDTRVHRNarHER 122
                               57*****999*********************9899986 PP

2zf-B_box24.46e-08123168342
                  zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                ++C+ +e+  ++  C+ +   lC  C   +H+       H+++p+
  Niben101Scf01409g06005.1 123 VWMCEVCEQAAASVTCKADAAALCVACDRDIHSAnplaqrHERIPV 168
                               689*******9*********************66899999998875 PP

3CCT69.58.7e-24370413144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Niben101Scf01409g06005.1 370 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRN 413
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.0E-582125IPR000315B-box-type zinc finger
CDDcd000211.55E-786125No hitNo description
PROSITE profilePS501198.84587125IPR000315B-box-type zinc finger
PROSITE profilePS5011910.836121168IPR000315B-box-type zinc finger
PfamPF006433.3E-6123168IPR000315B-box-type zinc finger
CDDcd000211.53E-8124168No hitNo description
SMARTSM003366.3E-9126168IPR000315B-box-type zinc finger
PfamPF062031.0E-17370412IPR010402CCT domain
PROSITE profilePS5101716.638370412IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MQWLFILKNP NSQTRIENST GQREERREKY GHIERRRKLF SRRMGCGGSS KTMRAREKKE  60
EKNMGILRGG ANCFPGGWGA AAVAKPCEYC HLDAALVFCR VDNMFMCLVC DTRVHRNARH  120
ERVWMCEVCE QAAASVTCKA DAAALCVACD RDIHSANPLA QRHERIPVVP FYDPVESIVK  180
STAATLLMSI NNSNSTSTTM NTTTAIAPEF SKATACLGHH IEDYNSDPWI SPNTMTTKLP  240
VNTMEMKPME FLFSDSENIL DFDHSVSIDT NYQPNYNSAN DSVVPVQSTI KPLPFQHQEK  300
HFEIDFTQSH IKSYTTPSLS HSVSSSSLDV GIVPDGSSIS EISYPFVRSV NSNIEMGNSA  360
QAEKLIEMNR EARVLRYREK KKNRKFEKTI RYASRKAYAE TRPRIKGRFA KRNDSAGAGV  420
DSDIDQIFSG AGFIANDLRY GVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608073.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A1J6JVW20.0A0A1J6JVW2_NICAT; Zinc finger protein constans-like 5
STRINGXP_009608073.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-98CONSTANS-like 5