PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01369g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 418aa    MW: 47363.6 Da    PI: 6.9837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01369g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM49.41.4e-152268148
                       NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                              lppGfrFhPtdeel+++yL+ kv + ++     i+evd++++ePw+Lp
  Niben101Scf01369g02001.1 22 LPPGFRFHPTDEELITFYLASKVFNGTFCG-IQIAEVDLNRCEPWELP 68
                              79*************************877.67**************9 PP

2NAM123.42e-386917713121
                       NAM  13 elvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                               el+++yL+ kv + ++     i+evd++++ePw+Lp+ +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+ev+s  +
  Niben101Scf01369g02001.1  69 ELITFYLASKVFNGTFCG-IQIAEVDLNRCEPWELPEVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREVYSVtN 152
                               9**************877.67***************8888999**************************************9878 PP

                       NAM  97 gelvglkktLvfykgrapkgektdW 121
                               g+l g+kktLvfykgrapkgekt+W
  Niben101Scf01369g02001.1 153 GALLGMKKTLVFYKGRAPKGEKTKW 177
                               999********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-161869IPR003441NAC domain
PROSITE profilePS5100540.53622203IPR003441NAC domain
PfamPF023654.3E-2123177IPR003441NAC domain
SuperFamilySSF1019413.4E-4269188IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MLSMEEILSE LSREDMNNEK GLPPGFRFHP TDEELITFYL ASKVFNGTFC GIQIAEVDLN  60
RCEPWELPEL ITFYLASKVF NGTFCGIQIA EVDLNRCEPW ELPEVAKMGE REWYFFSLRD  120
RKYPTGLRTN RATGAGYWKA TGKDREVYSV TNGALLGMKK TLVFYKGRAP KGEKTKWEEW  180
VICRILHKIG EKKNPIYQPA GQNYGYPTSL KTWPSSSFLN TAAAAEVAPN PILAETPNPK  240
TTTTTHWQES FQISQNSVQS LHNFYLFHHQ ENDLMKSLFN PIINVSQTNL FPINNNVLSS  300
ATSFSTSQST KKYKEDMNKN SSLSSFLVSN SKKNEKHQVP FMQANTTMKI EASFSPYSGC  360
YNDQNPMASN FGMNSSSDWS LVGIEGMHFN GGCTQSQMLL DHKNCPIKIA AESWPLDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-38111913171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796445.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like isoform X1
RefseqXP_009796446.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like isoform X2
TrEMBLA0A1U7Y3B50.0A0A1U7Y3B5_NICSY; protein CUP-SHAPED COTYLEDON 3-like isoform X1
STRINGXP_009796446.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.12e-77NAC family protein