PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01330g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 325aa    MW: 36401.9 Da    PI: 8.903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01330g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12e-54121391128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL +k+++ +++  ++i+++d++k+ePwdLp k+k + kewyfFs rd+ky+tg r+nrat+sgyWk+
  Niben101Scf01330g01003.1  12 LPPGFRFHPTDEELITYYLVNKISDASFTG-RAIADADLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGVRTNRATNSGYWKT 95 
                               79*************************999.89***************999999******************************* PP

                       NAM  86 tgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                               tgkdke++++ ++elvg+kktLvfykgrap+gek++Wvmheyr+
  Niben101Scf01330g01003.1  96 TGKDKEIFNSkTSELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 139
                               ********9867888***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-646161IPR003441NAC domain
PROSITE profilePS5100561.27712161IPR003441NAC domain
PfamPF023654.6E-2913139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELEVNKEES SLPPGFRFHP TDEELITYYL VNKISDASFT GRAIADADLN KSEPWDLPGK  60
AKMGGKEWYF FSLRDRKYPT GVRTNRATNS GYWKTTGKDK EIFNSKTSEL VGMKKTLVFY  120
KGRAPRGEKS NWVMHEYRIR SKSSYRTNKQ DEWVVCRIFQ KSAGMKKYPT NHSRTVVNPY  180
SLEINPNAMS SQIMMQPDHG FQFSMGRNDI NHASNYTNNF PIQHPQMNYN IGGSSSSGGG  240
GGDNFFTISG LNLNLGGGAA ASSQPVLRLM PLPPPPPPQV MNVQQEVMTS SMLDNCAITS  300
EAAGYGAEMN SAHYCADLDN YWATY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-551116716171NO APICAL MERISTEM PROTEIN
1ut4_B3e-551116716171NO APICAL MERISTEM PROTEIN
1ut7_A3e-551116716171NO APICAL MERISTEM PROTEIN
1ut7_B3e-551116716171NO APICAL MERISTEM PROTEIN
3swm_A4e-55916717174NAC domain-containing protein 19
3swm_B4e-55916717174NAC domain-containing protein 19
3swm_C4e-55916717174NAC domain-containing protein 19
3swm_D4e-55916717174NAC domain-containing protein 19
3swp_A4e-55916717174NAC domain-containing protein 19
3swp_B4e-55916717174NAC domain-containing protein 19
3swp_C4e-55916717174NAC domain-containing protein 19
3swp_D4e-55916717174NAC domain-containing protein 19
4dul_A3e-551116716171NAC domain-containing protein 19
4dul_B3e-551116716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601216.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
RefseqXP_016457772.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLA0A1S3Z0W30.0A0A1S3Z0W3_TOBAC; protein CUP-SHAPED COTYLEDON 1-like
STRINGXP_009601216.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-104NAC domain containing protein 38