PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01320g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 548aa    MW: 62423.8 Da    PI: 5.8856
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01320g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.2e-5661341129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyW
  Niben101Scf01320g01003.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPdKsLLPSKDMEWYFFSPRDRKYPNGTRTNRATKAGYW 89 
                               79****************************.99**************96435566888*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               katgkd++v s + + +g+kktLv+y+grap+g++t Wvmheyrle
  Niben101Scf01320g01003.1  90 KATGKDRKVNS-QMRPIGMKKTLVYYRGRAPHGTRTGWVMHEYRLE 134
                               **********9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-644156IPR003441NAC domain
PROSITE profilePS5100561.6916156IPR003441NAC domain
PfamPF023653.5E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPDKSLLPSK  60
DMEWYFFSPR DRKYPNGTRT NRATKAGYWK ATGKDRKVNS QMRPIGMKKT LVYYRGRAPH  120
GTRTGWVMHE YRLEERECEV ANGMQDAYAL CRVFKKSLNA PRIGDHYASA ASDRSSSIDV  180
YTEGSRFDDI DQSSDYGMPS AATSSSMAVH GSPLMNVAGP SHDDKWMQYL SDEAFTSINP  240
SFPTSNGAFP YHPSKVDIAL ECARLQHRFA LPPLEVQDFP QVGYVDSQSN DHLMYHQSTN  300
QTDIVQEILS VAQASHDLTN QDSWGGDYNY APPSDDFSFL THNNIQVHDL GNSFNFMEQL  360
KEDHSARYIA VTDFDDKTFL ENYKTVPIEN ISGPHKEEQD LQGEANGMHN SLNQREANNF  420
SLGFGNESFL DDEDTDGFSN SPSFEVYEKI EVSQGLFVAT RQAANTFYHQ VVPSKTVTVH  480
RDLVPVLVHD FPIRKIQENV TLLDTFMAFS RKTLSGVMRV TRPWKGKIST LIHMIAPLYT  540
FWSIWGIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B7e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A7e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_B7e-56116212171NO APICAL MERISTEM PROTEIN
4dul_A7e-56116212171NAC domain-containing protein 19
4dul_B7e-56116212171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009765145.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016466987.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A1S3ZRK80.0A0A1S3ZRK8_TOBAC; NAC domain-containing protein 86-like
TrEMBLA0A1U7VT990.0A0A1U7VT99_NICSY; NAC domain-containing protein 78-like
STRINGXP_009765145.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-142NAC domain containing protein 28