PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01247g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 155aa    MW: 18089.8 Da    PI: 6.112
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01247g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.82.8e-36111111101
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++r+kC ++C lapyfp++++++f+nv +lFG++n +kll+++ ++++e+++++l+ eA+++ ++PvyG++g+ +kl+ 
  Niben101Scf01247g03002.1  11 ACAACKHQRKKCDENCQLAPYFPSNRSEDFQNVYRLFGVNNTIKLLNSVADDQKEKTAETLILEANVWKENPVYGCLGIERKLRT 95 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkeel 101
                               ++e  ++el+++++++
  Niben101Scf01247g03002.1  96 EIEAYEKELEMVRKQI 111
                               ***********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.10310111IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3411108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MNADMLMFVG ACAACKHQRK KCDENCQLAP YFPSNRSEDF QNVYRLFGVN NTIKLLNSVA  60
DDQKEKTAET LILEANVWKE NPVYGCLGIE RKLRTEIEAY EKELEMVRKQ ISFCKEMVTL  120
QMQRQHLEEQ LDQSSLALVS PFDVHYHNKL LWVQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-221211112111LOB family transfactor Ramosa2.1
5ly0_B1e-221211112111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250866.11e-103PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A1J6I4F41e-102A0A1J6I4F4_NICAT; Lob domain-containing protein 27
STRINGXP_009801618.11e-102(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-29LOB domain-containing protein 22