PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01221g06003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 610aa    MW: 69162 Da    PI: 5.0588
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01221g06003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.66.4e-1277136261
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsely 61 
                                elL + A+ v+++++++a+++L+  ++ as +g+p+qR++ yf+ AL++r+ r+++++ 
  Niben101Scf01221g06003.1  77 AELLQASAQLVATRNFNRATKFLSLCNQSASAAGTPVQRIVYYFADALQHRIDREMEKIP 136
                               5789999***********************************************776664 PP

2GRAS235.42.6e-722396062374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl... 83 
                                elL + A+ v+++++++a+++L+  ++ as +g+p+qR++ yf+ AL++r+ r+++++  + +   ++ +n +eel ++ l   
  Niben101Scf01221g06003.1 239 AELLQASAQLVATRNFNRATKFLSLCNQSASAAGTPVQRIVYYFADALQHRIDREMEKIPITREEDIEAYSNDVEELVMD-Lepa 322
                               5789999***********************************************88888766655444444444443333.2346 PP

                      GRAS  84 .fse..vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetger 164
                                f +  ++P+ +++ +t  qaIl++v +++rvH iD+ i+ G +W +++q+La+R+e p  +l+i +vg+    sk+++e +g+r
  Niben101Scf01221g06003.1 323 vFAKrpLFPYRQVTSFTGIQAILDSVTTAKRVHLIDLCIKSGSHWTTFMQTLADRDECPLkHLKISAVGR----SKKKMEDVGRR 403
                               6654449*************************************************65544*********....9********** PP

                      GRAS 165 Lakf.AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                               L+ f Ae+l+v+f+f++ v+++l +l+ e+++v+ +E++aV + + l ++l+ + +++s    +++++ks +P ++v+ve  a++
  Niben101Scf01221g06003.1 404 LSAFsAETLNVSFSFKT-VVSDLRNLKSESFEVEVDEVVAVYSDVILWTMLAWPNDMDS----LMEVIKSFNPCIMVLVEGIANT 483
                               ***97899*********.7999****************************966666666....********************** PP

                      GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                                 ++F e f e+l+y+sal ++ e+     ++    +E +++++ i+n+++  g e + r  +l++Wr+ + ++G+ + +ls+  
  Niben101Scf01221g06003.1 484 YLPDFIESFNETLSYFSALTECSEVL----HKGIPIYEGFYIQKVIRNMITYHGVETVPRLGNLKEWRDLFAKFGMVETELSHLS 564
                               ************************99....89999************************************************** PP

                      GRAS 334 akqaklllrkvksdg.yrveeesgslvlgWkdrpLvsvSaWr 374
                                 +a+ll  k +++g  + e ++++lv+ Wk+ p++ vSaW+
  Niben101Scf01221g06003.1 565 LIEASLLFDKSEFRGlCTCELDEECLVISWKRTPIICVSAWK 606
                               ************999789999********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035142.2E-977136IPR005202Transcription factor GRAS
PROSITE profilePS5098535.027212585IPR005202Transcription factor GRAS
PfamPF035148.9E-70239606IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDFSNARNME KANKRGDHAE EKQESLVLSS APTIMKIARQ RLLNHIAQKS DAYSIIFNPP  60
TVNSGLSPEL EQDLDLAELL QASAQLVATR NFNRATKFLS LCNQSASAAG TPVQRIVYYF  120
ADALQHRIDR EMEKIPITRE EDIEAYSNDV EELVMDLEPA VFAKRPNARN MEKANKRGDH  180
AEEKQESLVL SSAPTIMKIA RQRLLNHIAQ KSDAYSIIFN PPTVNSGLSP ELEQDLDLAE  240
LLQASAQLVA TRNFNRATKF LSLCNQSASA AGTPVQRIVY YFADALQHRI DREMEKIPIT  300
REEDIEAYSN DVEELVMDLE PAVFAKRPLF PYRQVTSFTG IQAILDSVTT AKRVHLIDLC  360
IKSGSHWTTF MQTLADRDEC PLKHLKISAV GRSKKKMEDV GRRLSAFSAE TLNVSFSFKT  420
VVSDLRNLKS ESFEVEVDEV VAVYSDVILW TMLAWPNDMD SLMEVIKSFN PCIMVLVEGI  480
ANTYLPDFIE SFNETLSYFS ALTECSEVLH KGIPIYEGFY IQKVIRNMIT YHGVETVPRL  540
GNLKEWRDLF AKFGMVETEL SHLSLIEASL LFDKSEFRGL CTCELDEECL VISWKRTPII  600
CVSAWKFQQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2826160626375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798274.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016450439.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S3YE770.0A0A1S3YE77_TOBAC; DELLA protein RGL1-like
TrEMBLA0A1U7YGB00.0A0A1U7YGB0_NICSY; DELLA protein RGL1-like
STRINGXP_009798274.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.19e-35RGA-like 1