PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01209g02015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 286aa    MW: 31942.9 Da    PI: 6.7673
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01209g02015.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.44.7e-19234267134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C++C  tkTp+WR gp g+ktLCnaCG++y+k +
  Niben101Scf01209g02015.1 234 CVHCEITKTPQWRAGPMGPKTLCNACGVRYKKGR 267
                               ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.8E-14227280No hitNo description
PROSITE profilePS5011411.635228264IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-17228282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-15232266IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.23E-14233280No hitNo description
PfamPF003201.2E-16234268IPR000679Zinc finger, GATA-type
PROSITE patternPS003440234259IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGSNLVQEID CASFFDHMDD LIEFSPENEC GDLDSTDCKN FTSICNDPLP DSDPLFFCSH  60
RNSPSDFSAE LLVPYEDIVQ LEWLSTFVED SFSCGGLTMG KEHFPVNKEP SHSKFMSSSP  120
VSVLESSSSS RSTSSSGAEK TTPPLSPCHR GTQRARRNRP RPAAFNPRPV NQLMSPTSSF  180
TEIHQQLVAP EDTLESDFGE SLMKKKKRIK FSIPLAPVDT NHNYQWAPQT VRKCVHCEIT  240
KTPQWRAGPM GPKTLCNACG VRYKKGRLFP EYRPAASRTF VPSLHS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802378.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_009802379.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016473478.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016473479.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLM1CLQ91e-135M1CLQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000701341e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23452358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-30GATA family protein