PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01150g05007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 687aa    MW: 76104.6 Da    PI: 6.5723
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01150g05007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.52e-2970154187
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW++qe+ aL+++r+em+  +r+++lk+plWeevs+km++ gf+rs+k+Ckek+en+ k++k++k+g+ ++   + +t+++f+ql
  Niben101Scf01150g05007.1  70 RWPRQETIALLKIRSEMDLVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENVYKYHKRTKDGRASK--ADGKTYRFFEQL 152
                               8********************************************************************96..66678******* PP

                  trihelix  86 ea 87 
                               ea
  Niben101Scf01150g05007.1 153 EA 154
                               85 PP

2trihelix103.21.9e-32489574187
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               rW+k ev aLi +r++++ +++++  k+plWee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql
  Niben101Scf01150g05007.1 489 RWPKAEVEALIMLRTQLDVKYQENGPKGPLWEEISAGMKKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQL 572
                               8*********************************************************************8.99*********** PP

                  trihelix  86 ea 87 
                               +a
  Niben101Scf01150g05007.1 573 DA 574
                               85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.005267129IPR001005SANT/Myb domain
CDDcd122032.22E-2669134No hitNo description
PfamPF138372.0E-1969155No hitNo description
PROSITE profilePS500906.88869127IPR017877Myb-like domain
PROSITE profilePS500907.259482546IPR017877Myb-like domain
SMARTSM007172.6E-4486548IPR001005SANT/Myb domain
PfamPF138376.2E-23488575No hitNo description
CDDcd122034.27E-29488553No hitNo description
Gene3DG3DSA:1.10.10.604.3E-4488545IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MLGVSGIISS TNSGGGGENP ESGGGAASGG SSEIAIGGGG VSISGGFMTE EDRAIRNMEE  60
GERNSGGGNR WPRQETIALL KIRSEMDLVF RDSSLKGPLW EEVSRKMADL GFHRSAKKCK  120
EKFENVYKYH KRTKDGRASK ADGKTYRFFE QLEALENNPS SHHSLLLPPP ITSSRPPPPP  180
LEATPINMAM PMPSGNANTI NLQLPASQQA TTTVTVSSAP PNNSSNIFVS SHQNTISHQN  240
IPLSSSMAPS SQPSPQPANN PINNLQANTN FPSHDQNISA MSYSTSSSTS SDEDIQRRHK  300
KKRKWKDFFE RLMKDVIDKQ EDLQRRFLET LEKRERDRMV REEAWRVQEV ARMNREHDLL  360
VQERSTAAAK DAAVISFLQK ITEQQNIQIP SNINVAPPSA QVQIQLPENP PPPSETRSQV  420
VHQQTQPTAV LVSPAPTQPS PATPAPISLP ATIPAQSLPL TPPVPAKSVE LTPKSDNGGE  480
GYSPASSSRW PKAEVEALIM LRTQLDVKYQ ENGPKGPLWE EISAGMKKLG YNRNAKRCKE  540
KWENINKYFK KVKESNKKRP EDSKTCPYFH QLDALYKEKA KNETSSSFSN PSASGFALNP  600
ENNPMMPIMA RPEQQWPRPP HHQQPQQHHE STRMDHDHES DNMDQDEDDE EEEDEDEENA  660
YEIVANKQQS SMAAANSTTT TTATTTV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295302QRRHKKKR
2295303QRRHKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618661.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A1S3XDN40.0A0A1S3XDN4_TOBAC; trihelix transcription factor GTL1-like
STRINGXP_009618661.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-82Trihelix family protein