PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01143g10001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 327aa    MW: 36682.6 Da    PI: 7.8908
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01143g10001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP95.41.1e-2951149389
                       TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                               g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++WL+++ k++i++l+ ++ ++  +++ +s+++ +++ + 
  Niben101Scf01143g10001.1  51 GGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIEATKHEIDKLPPLQIPPGYFAQFQSDHQFDHAANL 135
                               78*************************************************************8888755522222222221111 PP

                       TCP  88 g............k 89 
                               +             
  Niben101Scf01143g10001.1 136 RakskvidtdtvyG 149
                               12333333433331 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.1E-2752157IPR005333Transcription factor, TCP
PROSITE profilePS5136929.24752110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MNSRGNHFQA KQESGGTNNS KLTSKATTST SSRQWGGFKN PRIVRVSRTF GGKDRHSKVC  60
TIRGLRDRRI RLSVPTAIQL YDLQDRLGLS QPSKVVDWLI EATKHEIDKL PPLQIPPGYF  120
AQFQSDHQFD HAANLRAKSK VIDTDTVYGK NKSIASNEQE NQEEIGGYVP QISAQSFFPL  180
GNRSPNLPGL INNSMPFNSY YPWEPNSNLS LSHFGQPQIE ESSQNNFPLS LASSLSLPSG  240
SQLYFNPIAT TFSPMISPYM TNYPIENDPR AQLNHFHFLS SSSQHVLTNP PVSTLNLIKP  300
FSQNDDPRWI HSREDDDDSQ PHEGGDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A8e-1957111155Putative transcription factor PCF6
5zkt_B8e-1957111155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781748.10.0PREDICTED: transcription factor TCP5-like
RefseqXP_016450456.10.0PREDICTED: transcription factor TCP5-like
TrEMBLA0A1S3YDZ20.0A0A1S3YDZ2_TOBAC; transcription factor TCP5-like
TrEMBLA0A1U7WT270.0A0A1U7WT27_NICSY; transcription factor TCP5-like
STRINGXP_009781748.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5