PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01143g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 523aa    MW: 57448.4 Da    PI: 9.1253
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01143g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.5e-41163238277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD +krsCr+rLa+hnerrrk++
  Niben101Scf01143g06001.1 163 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDYGKRSCRKRLAGHNERRRKPH 238
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.2E-33157224IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.522160237IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38161241IPR004333Transcription factor, SBP-box
PfamPF031103.5E-31163236IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MESWSYLSGG KGFISEESVS INDGMGRAKN GLMGWELKTP NSYMVCSSQE GSTNNQGFPE  60
LGSQNLMRKT MFSDQSSFGS VAASPSAYSG EDKSKSSSKL SSSVVDLNSR DSSLIDLKLG  120
RFPDQIDVNV YKSPKIMPNV SCAESIVPAK RMRAGGLSSH PFCQVQGCGK DLSSCKDYHK  180
RHKVCEVHSK TAKVIVNGIE QRFCQQCSRF HLLAEFDYGK RSCRKRLAGH NERRRKPHTG  240
TRFRGTSFAT SSFACQDILG GRFLHQPKFE MNDWYKNVKV EDGVERSPQL AMPFSNGQLQ  300
PKSFFMSYHA KKQCQPLHDE GQPAVTTSRI NESTMSSLHD MRGSDFVSPS LFHTTSTGSE  360
VLHVLDISST IHGLSGISNS SNALSLLSSQ SRGPSNHSTV LRATHPLISP SNNSRYSVTQ  420
ASKEVLGLRP QDSAGRMSNT FNSSGVNSAE GGLDQILFPS NTYGVNGIIQ GPNFVNHKDQ  480
LSCEDEPTID LLQLSSQLQR VEHQRLSMQV KQGSNTFPGL RIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-29156236484squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019230968.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A314KID50.0A0A314KID5_NICAT; Squamosa promoter-binding-like protein 6
STRINGXP_009622387.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-44SBP family protein