PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01124g04009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 198aa    MW: 22024 Da    PI: 8.9592
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01124g04009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.5e-41451441100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l +++e++r d+++slvyeA++r+rdPvyG++g i++lqq
  Niben101Scf01124g04009.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVSENQRADTANSLVYEANVRLRDPVYGCMGAISALQQ 129
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q++ l+ el+++++e
  Niben101Scf01124g04009.1 130 QVQALQMELNVVRAE 144
                               **********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.19944145IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4145142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MSRERERYEE IGKKIKREAD DYSQMGRRYL LGNPGTTTTL NTVTPCAACK LLRRRCAQEC  60
PFSPYFSPHE PQKFASVHKV FGASNVSKML MEVSENQRAD TANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQALQMELNV VRAEILKYKF GDTATLTNIP SSHISSLLAS GAVSIVTAQP  180
PPPPPXXXXX XXXXXXXX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-46381624125LOB family transfactor Ramosa2.1
5ly0_B8e-46381624125LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019227654.11e-120PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-80LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A314KQ001e-118A0A314KQ00_NICAT; Lob domain-containing protein 15
STRINGXP_009591808.11e-111(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-74LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]