PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01109g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 607aa    MW: 66436.9 Da    PI: 6.2006
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01109g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.32.3e-22244286244
                       WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  Niben101Scf01109g00006.1 244 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHVHRGRPRSRKHVE 286
                               69***************************************98 PP

2QLQ50.85.2e-18183217236
                       QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                               +FT++Q+ +L+ Q+++yKy+++  PvPp+Ll+ i+
  Niben101Scf01109g00006.1 183 PFTWSQWKELEKQAMIYKYMVSAIPVPPDLLLSIC 217
                               8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-8182218IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.022183218IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.2E-13183217IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.445243287IPR014977WRC domain
PfamPF088791.8E-18245286IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MGMEEGSING FNVSDKANLN GGKISTTICY NFQLQNTVSF PSKIMMGHNQ DPHRPFSDDD  60
DNGGGGDSRP TLNHNGANKM PSSDEHNVYS DPSFLPPPPP PPVTGGAAVV RTFQPFSIST  120
NSSPANKMPS SDEHNVYSDP SFLPPPPPPP VTGGAAVVRT FQPFSISTNS SPVEGMAAAL  180
GLPFTWSQWK ELEKQAMIYK YMVSAIPVPP DLLLSICTNS SGASLTTLAS GSVQGQRCRN  240
IRDLEPGRCK RTDGKKWRCS RDVAPHQKYC ERHVHRGRPR SRKHVEVHAT LSNNNDNKKT  300
RNHPVTLEST PIAIPKPPPA GQTNSPSTQP VRSAFQYMEG PLFLHDKMRQ NISTDPSFNE  360
LHSSGWTIER ELVVAKAGAG QQWQYLMDSN IHPADWQDSY REEALNLLAC RDLERTEDVG  420
MRHNGEFNFM INPELFSLDK QSVKEAPRDL INAWSNDNIY NNSNNENMEE ASLWPSEGNI  480
SPSSLTLSMA MAAGNVLDDE DMGLKSNVMN NTHQNKSWEK FAWVPFASGG PLAEVLHPSS  540
SINQGENPAS SYTSNCDSIS PAATTVSSPS GVLQRTMLSH SDGSVCNSPI LAPPTHTSET  600
VPFQWLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597555.10.0PREDICTED: growth-regulating factor 7-like isoform X2
TrEMBLA0A1S3Y4960.0A0A1S3Y496_TOBAC; growth-regulating factor 3-like isoform X2
STRINGXP_009597554.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-36growth-regulating factor 7