PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01105g01021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 613aa    MW: 67169.7 Da    PI: 8.6302
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01105g01021.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.7e-18242275134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  Niben101Scf01105g01021.1 242 CQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 275
                               *******************************987 PP

2GATA56.24.7e-18513546134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  Niben101Scf01105g01021.1 513 CQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 546
                               *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-17236286IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.213236272IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14240299No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14240273IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.10E-15241298No hitNo description
PROSITE patternPS003440242267IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15242275IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.213507543IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-17507557IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14511570No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14511544IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.10E-15512569No hitNo description
PfamPF003201.1E-15513546IPR000679Zinc finger, GATA-type
PROSITE patternPS003440513538IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MGSNLVDDID CGSFFDHIDD LIDFPLENEG AGLSSTCKDF PSIWNDPLPD SDSLFSGSHR  60
NSASDFSAEL SIPYEDIVQL EWLSTFVEDS FSGGGSTLGK ENFPFNKETS EAKFQTSSPV  120
SVLESSSSSS SSSCSVEKTV PLSSPCHRGP QRARSKRPRP AMFNPVPAIQ LISPTSSFTE  180
IPQPFVARGF ASESENFAES PMKKILKPAA VEQKKKKKLK LSFPSARVEA NQNPVAQTIR  240
KCQHCEITKT PQWRAGPMGP KTLCNACGVR YKSGRLFPEY RPAASPTFVP SIHSNSHKKV  300
IEMRTKVVPD SNATIARTAP PATITQPEFD PSNKESVEEE NKFGYEDIVQ LEWLSTFVED  360
SFSGGGSTLG KENFPFNKET SEAKFQTSSP VSVLESSSSS SSSSCSVEKT VPLSSPCHRG  420
PQRARSKRPR PAMFNPVPAI QLISPTSSFT EIPQPFVARG FASESENFAE SPMKKILKPA  480
AVEQKKKKKL KLSFPSARVE ANQNPVAQTI RKCQHCEITK TPQWRAGPMG PKTLCNACGV  540
RYKSGRLFPE YRPAASPTFV PSIHSNSHKK VIEMRTKVVP DSNATIARTA PPATITQPEF  600
DPSNKESVEE ENK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1426430KRPRP
2484491KKKKKLKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016503813.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016503812.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016503811.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLQ76DX90.0Q76DX9_TOBAC; AG-motif binding protein-5
STRINGPGSC0003DMT4000599891e-167(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23452358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-38GATA family protein