PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01094g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 463aa    MW: 51594 Da    PI: 5.7282
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01094g01010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ371.33e-1141954021217
                       VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipeceg 82 
                               pppsaflgpkc+lwdc+rpa gs+w+q   dycs +ha+la neg pgt pv+rp gi+lkd+llf+alsak+qgk+vgipece 
  Niben101Scf01094g01010.1 195 PPPSAFLGPKCSLWDCPRPAMGSDWCQkshDYCSDYHASLAPNEGYPGTPPVVRPMGIGLKDNLLFQALSAKAQGKDVGIPECE- 278
                               89***********************976668****************************************************8. PP

                       VOZ  83 aatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfew 167
                                          elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+ glkrsyymdpqp++++ew
  Niben101Scf01094g01010.1 279 -----------ELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEYRGLKRSYYMDPQPMKNLEW 352
                               ...........9************************************************************************* PP

                       VOZ 168 hlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                               hlyeyein++da+alyrlelklvd+kks+kgkv+k+s+adlqk++grlta
  Niben101Scf01094g01010.1 353 HLYEYEINKYDACALYRLELKLVDGKKSPKGKVTKESVADLQKQMGRLTA 402
                               ************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
RQHFDPPYLP IEGFVSSALI GMGKGSKSGA GKTASHQLFK DKAKNRVDDL QGVFTNLQSA  60
RKESRTYDVG VLEEQGGSRV SSDIYRLLLG EEEDDATSAL AAPKPEPDAQ KNDVAAFQEG  120
FNVTPVLQEQ GYQLVDQSKS MPLVVNNAVI NNLGIATQKD YNSFDLQQDF DQYFPGFDAL  180
NLCLEDVLPP VHISPPPSAF LGPKCSLWDC PRPAMGSDWC QKSHDYCSDY HASLAPNEGY  240
PGTPPVVRPM GIGLKDNLLF QALSAKAQGK DVGIPECEEL FDLKVVEGET IREWLFFDKP  300
RRAFESGNRK QRSLPDYNGR GWHESRKQVM NEYRGLKRSY YMDPQPMKNL EWHLYEYEIN  360
KYDACALYRL ELKLVDGKKS PKGKVTKESV ADLQKQMGRL TAEFPSENKR SVKGRAKANS  420
KDVAINTHAV PNLTVPASEG LDYGTGAPFP DYLVDNLGGY YVT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776508.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009776509.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016491038.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016491039.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-173VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S4BQG30.0A0A1S4BQG3_TOBAC; transcription factor VOZ1-like
TrEMBLA0A1U7WPA80.0A0A1U7WPA8_NICSY; transcription factor VOZ1-like
STRINGXP_009776508.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-173vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]