PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01062g01005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 233aa    MW: 27542.4 Da    PI: 8.0544
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01062g01005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM65.41.7e-20131423128
                       NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLp.kkvka.eekewyfFskrdkkyat.gkrknratksgy 82 
                               +G+rFhPt+ el+ ++L + ++g+ l+ e + ++  diy    Pw++  ++ ++ eek  y F++ +kk+++  +r +r+ + g+
  Niben101Scf01062g01005.1  13 MGVRFHPTEAELI-NFLIRFLKGELLQSECHnFELSDIYGDqPPWEIFgANSDHpEEKVRYIFTRLKKKKKReHSRVRRTCAYGT 96 
                               7************.99***99999977755548888**987368***73333332445559999877776652778999999*** PP

                       NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               Wk +    ++++ kg++vg ++ + f + +++  ++  W+m ey++
  Niben101Scf01062g01005.1  97 WKGQTGIDPIKKGKGTVVGFRRCFKFQSRSKEGEHNKIWLMREYSV 142
                               **8888899**99*************977777777888******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-243164IPR003441NAC domain
PROSITE profilePS5100525.48411165IPR003441NAC domain
PfamPF023651.7E-1313142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MSMVPAARRG CIMGVRFHPT EAELINFLIR FLKGELLQSE CHNFELSDIY GDQPPWEIFG  60
ANSDHPEEKV RYIFTRLKKK KKREHSRVRR TCAYGTWKGQ TGIDPIKKGK GTVVGFRRCF  120
KFQSRSKEGE HNKIWLMREY SVGDDFFREN NIPKEDIVVC RIKKNIRSMK NHWVNMEEQD  180
VPKVIEAMYE DYCTTVQPET ICQAADQRQV NDWSNYQQEF NWADDMLIGI DDF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794658.11e-148PREDICTED: protein SOMBRERO-like
RefseqXP_016455277.11e-148PREDICTED: protein SOMBRERO-like
RefseqXP_016461013.11e-147PREDICTED: NAC domain-containing protein 53-like
TrEMBLB3VK721e-149B3VK72_TOBAC; NAC transcription factor
STRINGXP_009794658.11e-147(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-12NAC domain containing protein 2