PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00960g04009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 601aa    MW: 68235 Da    PI: 7.6336
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00960g04009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.3e-1081121545
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                               k++rr+++NReAAr+sR RKka++++Le+   +L +  ++L
  Niben101Scf00960g04009.1  81 KVQRRLAQNREAARKSRMRKKAYVQQLETSRMKLAQLEMEL 121
                               99**************************9766666655544 PP

2bZIP_131.34.3e-10319359545
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                               k++rr+++NReAAr+sR RKka++++Le+   +L +  ++L
  Niben101Scf00960g04009.1 319 KVQRRLAQNREAARKSRMRKKAYVQQLETSRMKLAQLEMEL 359
                               99**************************9766666655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-577137IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.23279123IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.56E-781119No hitNo description
PfamPF001703.9E-781121IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-781124No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.0E-28168238IPR025422Transcription factor TGA like domain
SMARTSM003382.0E-5315375IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.232317361IPR004827Basic-leucine zipper domain
PfamPF001703.9E-7319359IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.56E-7319357No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-7319362No hitNo description
PROSITE patternPS000360322337IPR004827Basic-leucine zipper domain
PfamPF141443.4E-29406478IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MNMSSPSTQF APTTRMGIFE PFHHMSMWED AFKGEFMPGT GACMVAQPND RVDDKSGYTS  60
SEQLIPSGSE DNQAGKSVSE KVQRRLAQNR EAARKSRMRK KAYVQQLETS RMKLAQLEME  120
LERARQQGLY VLGSNGNMGL SATINPGIAA FEIEYGLWVE EQQKKNVELR NVLQSHVSEM  180
ELQLLVESVL SHYYNLFRMK ADAAKADVFY LMSGMWRTSV ERFFLWIGGF KPSELINSMN  240
MSSPSTQFAP TTRMGIFEPF HHMSMWEDAF KGEFMPGTGA CMVAQPNDRV DDKSGYTSSE  300
QLIPSGSEDN QAGKSVSEKV QRRLAQNREA ARKSRMRKKA YVQQLETSRM KLAQLEMELE  360
RARQQGLYVL GSNGNMGLSA TINPGIAAFE IEYGLWVEEQ QKKNVELRNV LQSHVSEMEL  420
QLLVESVLSH YYNLFRMKAD AAKADVFYLM SGMWRTSVER FFLWIGGFKP SELINVVMPQ  480
LEPLSDQQIV KICNLRHCCQ QAEDALTQGM DKLQQTLAQS ILTMTTGMGS YSSQMLSSME  540
KLEALESFVN QADHLRHQTL QQMSLILTTR QTARGLLAFG EYLQRLRALS PLWAARPREP  600
T
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588814.10.0PREDICTED: transcription factor TGA1
RefseqXP_016476198.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392371e-149TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A1S4AIE20.0A0A1S4AIE2_TOBAC; TGA7
STRINGXP_009588814.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-151bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]