PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00944g04003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 251aa    MW: 29202.7 Da    PI: 4.8135
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00944g04003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.42.9e-3210105196
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrF P+deelv++yL +k++++++    ++ e+d++++ePw+Lp  +k +++ewyfFs rd+ky+ g r+nrat sgyWka
  Niben101Scf00944g04003.1  10 LPPGFRFCPSDEELVCHYLFNKITNEEIIK-GTLVEIDLHTCEPWQLPDLAKLNSSEWYFFSFRDRKYTIGFRANRATISGYWKA 93 
                               79*************************766.78***************77777889***************************** PP

                       NAM  86 tgkdkevlsk.k 96 
                               tgkd++vl+  +
  Niben101Scf00944g04003.1  94 TGKDRTVLDPcT 105
                               *******99742 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-378119IPR003441NAC domain
PROSITE profilePS5100532.23610153IPR003441NAC domain
PfamPF023655.6E-1611105IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDLREIGATL PPGFRFCPSD EELVCHYLFN KITNEEIIKG TLVEIDLHTC EPWQLPDLAK  60
LNSSEWYFFS FRDRKYTIGF RANRATISGY WKATGKDRTV LDPCTRATED WVLCRVFHKT  120
KCENNNNCTN NLSPENMYEA AVTSPKLYKY SLNYDINNQD PPYQSQNSNT IHHHLFDLLV  180
KNHLQLSHQE TNEVSKDETT VNLSKCSQEV DQYGLMFDMD FEVPCLQDGV HSSLEDMKFD  240
DENSMVFHLN C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-281010015105Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801114.11e-158PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_016485618.11e-158PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A1S4B9Z41e-157A0A1S4B9Z4_TOBAC; protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A1U7YPF41e-157A0A1U7YPF4_NICSY; protein CUP-SHAPED COTYLEDON 3-like
STRINGXP_009801114.11e-158(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.22e-61NAC domain containing protein 74