PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00911g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 267aa    MW: 29687.4 Da    PI: 10.2519
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00911g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA84.41.7e-26102156258
                 CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                p++VNaKQy++Il+RR+ Rak e e+kl  k rkp+lh SRh hA+rRpRg gGrF
  Niben101Scf00911g01003.1 102 GPIFVNAKQYHGILRRRKFRAK-EMENKL-LKPRKPFLHLSRHLHAMRRPRGGGGRF 156
                               69*******************9.566999.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-2999159IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115230.989100159IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-20103125IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-22103156IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-20133156IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSMHTIFTKG NETAPWWGSL VPQSMEPFGH LKSASMEQPS KSKGDTMSFE SQSDDSKSSE  60
KAENLSNVVD GVSTKLSNMD YQGHFEPLGR IMLPLNLTSD EGPIFVNAKQ YHGILRRRKF  120
RAKEMENKLL KPRKPFLHLS RHLHAMRRPR GGGGRFLNTR KMNGSNNDGT TKTSNRKSLP  180
TGSQNSEVPQ SDHIGNLNSP KEKTSRMSCN SSEVTSFYSK GNLDAYTVHN PKPSVQAFFD  240
MMNTGHDILM GSKWGFAAAD SCGNLNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A3e-15101159262HAPB protein
4g92_A3e-15101159262HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019254537.11e-155PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_019254538.11e-155PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_019254539.11e-155PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A1J6I0091e-154A0A1J6I009_NICAT; Nuclear transcription factor y subunit a-2
STRINGXP_009613978.11e-128(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.35e-31nuclear factor Y, subunit A10