PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00792g04006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 511aa    MW: 57933.6 Da    PI: 4.5841
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00792g04006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.65.1e-53101451128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.........kvkaeekewyfFskrdkkyatgkrknr 76 
                               l+pGfrFhPtdeelv +yL++k++g++++    i+++diykvePwdLp          ++k+++ ewyfFs  dkky +  r+nr
  Niben101Scf00792g04006.1  10 LAPGFRFHPTDEELVRYYLRRKITGRPIKS-APISDIDIYKVEPWDLPVerygaigksRLKTRDLEWYFFSVLDKKYGNRARTNR 93 
                               579************************999.78***************54789888776677888******************** PP

                       NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               at++gyWk+tgkd++v+++k+++vg+kktLv+++grapkg++t+Wvmheyrl
  Niben101Scf00792g04006.1  94 ATEKGYWKTTGKDRAVHRNKSQVVGMKKTLVYHSGRAPKGQRTNWVMHEYRL 145
                               **************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-579169IPR003441NAC domain
PROSITE profilePS5100555.85810169IPR003441NAC domain
PfamPF023653.0E-2812145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MESRGSLKSL APGFRFHPTD EELVRYYLRR KITGRPIKSA PISDIDIYKV EPWDLPVERY  60
GAIGKSRLKT RDLEWYFFSV LDKKYGNRAR TNRATEKGYW KTTGKDRAVH RNKSQVVGMK  120
KTLVYHSGRA PKGQRTNWVM HEYRLIDEEL DRAGIPQKDA FVVCRVFQKS GAGPKNGEQY  180
GAPFIEEEWE DDELQVLPKD EASEEFVFDD IYLDGIELDQ ILGTKTTLNS APLPLDYCYG  240
ENGSSEETNN SSDEQNLLQQ PDELKPVDLA VQQNVDVDPV MHEYIGESSK NVNSEDVDYL  300
LNEPTVNATD DLQFMEEAFL EANDLSNPIE VDSSGFDMLE EYLTFFDAND DFQDMGLGEN  360
KNDFASSSKL EPTRFGSDRQ YPFMKKASQM LGNIHAPPAF ASEFPTKDAT LRLNSLSRSS  420
SSVQITAGFQ IRDVTGGSNA TGWPLGKHAD YNIILSFDIS RRSDDSAMES FSSIHPGKTT  480
SIISRDWFYY LFFSFLMLCM SFKIGTIICA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-42917516171NO APICAL MERISTEM PROTEIN
1ut4_B7e-42917516171NO APICAL MERISTEM PROTEIN
1ut7_A7e-42917516171NO APICAL MERISTEM PROTEIN
1ut7_B7e-42917516171NO APICAL MERISTEM PROTEIN
3swm_A8e-42917519174NAC domain-containing protein 19
3swm_B8e-42917519174NAC domain-containing protein 19
3swm_C8e-42917519174NAC domain-containing protein 19
3swm_D8e-42917519174NAC domain-containing protein 19
3swp_A8e-42917519174NAC domain-containing protein 19
3swp_B8e-42917519174NAC domain-containing protein 19
3swp_C8e-42917519174NAC domain-containing protein 19
3swp_D8e-42917519174NAC domain-containing protein 19
4dul_A7e-42917516171NAC domain-containing protein 19
4dul_B7e-42917516171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599412.10.0PREDICTED: NAC domain-containing protein 53-like isoform X1
TrEMBLA0A1J6KMA50.0A0A1J6KMA5_NICAT; Nac domain-containing protein 78
STRINGXP_009599412.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-115NAC domain containing protein 2