PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00781g06015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 303aa    MW: 33541.1 Da    PI: 8.8946
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00781g06015.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.39.1e-32145201158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep+YVNaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Niben101Scf00781g06015.1 145 EEPVYVNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 201
                               69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-36143204IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039144204IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-27146201IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-24147169IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860149169IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-24178201IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MPTIAEHDGR QLQTELHITS QPTIQMQSWW QGYGDNTMPL ASENTVAQGN ADGGNEEKET  60
NAQATESGSK GNNMQYKNHL KHITSTTAAI MGEQQKGLTG HSAMLTSYPY PDLQYGGMMT  120
YGAPVHPHLF EIHHARMPLP LDMEEEPVYV NAKQYHGILR RRQIRAKAEL EKKAIKARKP  180
YLHESRHQHA MRRARGTGGR FLNTKKLNDM DCTTEEPKKY GATIPTHSGN SSGSGSSDQR  240
EKEGSTVQDM HKGRGRSFST SNGHGSSVYF SENTGNEQRN GYYGCGSWSL LVSQASRGAA  300
SDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20145205262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019240212.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLA0A1J6ITI10.0A0A1J6ITI1_NICAT; Nuclear transcription factor y subunit a-1
STRINGXP_009626580.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.11e-28nuclear factor Y, subunit A7