PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00773g14025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 299aa    MW: 33630.1 Da    PI: 8.4665
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00773g14025.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-40111101100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+l+r+C+++C +apyf ++++kkfanvhk+FGasnv+k+l+++p+++red+++slvyeAe+r++dPvyG++g i +lq+
  Niben101Scf00773g14025.1  11 SCAACKFLKRRCTSNCQFAPYFRSDESKKFANVHKVFGASNVIKILNEVPQDQREDTVNSLVYEAEVRLKDPVYGCIGAIASLQR 95 
                               6************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               ++ +l+++l +++++
  Niben101Scf00773g14025.1  96 KMVELQHDLMVTRAH 110
                               ********9998876 PP

2DUF260129.11.9e-401382371100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++p+++red+++slvyeAe+r+r+PvyG++g i +lq+
  Niben101Scf00773g14025.1 138 SCAACKFLKRRCTSNCQFAPYFRSDEPKKFANVHKVFGASNVIKILNEVPQDQREDTVNSLVYEAEVRLREPVYGCIGAIASLQR 222
                               6************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               ++ +l+++l +++++
  Niben101Scf00773g14025.1 223 KMVELQHDLMVTRAH 237
                               ********9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.26510111IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4011108IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089125.104137238IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-40138235IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKSNESRSSS SCAACKFLKR RCTSNCQFAP YFRSDESKKF ANVHKVFGAS NVIKILNEVP  60
QDQREDTVNS LVYEAEVRLK DPVYGCIGAI ASLQRKMVEL QHDLMVTRAH LAYYEAKPST  120
SFKKKEAMKS NESRSSSSCA ACKFLKRRCT SNCQFAPYFR SDEPKKFANV HKVFGASNVI  180
KILNEVPQDQ REDTVNSLVY EAEVRLREPV YGCIGAIASL QRKMVELQHD LMVTRAHLAY  240
YEAKPSTCSF LDYDPLNVNG PSVFVDTSLS SGFLDNFSQN SFGIDNSGST NEFGQFPFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4282418114LOB family transfactor Ramosa2.1
5ly0_B2e-4282418114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019246692.11e-111PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL81e-54LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A1J6J1911e-110A0A1J6J191_NICAT; Lob domain-containing protein 21
STRINGXP_009623318.11e-110(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-51LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]