PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00736g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 314aa    MW: 34707.8 Da    PI: 8.9291
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00736g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.54e-32182238158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               d p+YVNaKQy++Il+RR+ Rakle+++kl  k+rkpylheSRh hA++R RgsgGrF
  Niben101Scf00736g01012.1 182 DGPIYVNAKQYHGILRRREIRAKLEAQNKL-VKARKPYLHESRHLHAVKRVRGSGGRF 238
                               57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.8E-36180241IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.332181241IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-27184238IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-23184206IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860186206IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-23215238IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAVRAQALPN RSLEQTCTCF VPHFAVNSST WWSSNEVQSS HSLSKNLTSE VIFQPPPCQQ  60
MKSLGLELQG DDSHSTQSNS NSPLEVTALG KTGSQDQCAS SGSVHDERHK QAQIKAISFI  120
RYPEYTTDCS QSEMAHSISH APIGYSDPYL SGFYAAYGPH VFPQMMGIAP ARLPLPLDLA  180
EDGPIYVNAK QYHGILRRRE IRAKLEAQNK LVKARKPYLH ESRHLHAVKR VRGSGGRFLS  240
TKKLQESTPN DHIHSNSSLD LVTREAHTSA FLSVRQDAAH NSAIFQQQQH DHRASSLSSH  300
MAVSLQSSRS TGIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20184242462NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016445413.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X2
TrEMBLA0A1S3XZP60.0A0A1S3XZP6_TOBAC; nuclear transcription factor Y subunit A-7-like isoform X2
STRINGXP_009631340.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-39nuclear factor Y, subunit A5