PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00570g05012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 368aa    MW: 42632.3 Da    PI: 7.0713
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00570g05012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP117.12.3e-361262352110
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                               + kkdrhski+T++g RdRR+Rls+++a++fFdLqd+L fdk+sktieWL+ ++k aikel ++  +++ e +++s++++  ++s
  Niben101Scf00570g05012.1 126 TEKKDRHSKICTAQGVRDRRMRLSLQIARKFFDLQDMLAFDKASKTIEWLFSKSKNAIKELSRN--IPQ-EINDNSDQNNLMSES 207
                               679*************************************************************..333.232233333333222 PP

                       TCP  87 sg....kaaksaakskksqksaasalnl 110
                               +     +++k  + ++k++ +a+++ n 
  Niben101Scf00570g05012.1 208 HIleceDHRKLRKMESKDKPKAKTMENT 235
                               2233432222222222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-37126238IPR005333Transcription factor, TCP
PROSITE profilePS5136936.145128186IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MFPKSNINDH FSYTSQELLQ HSYTHHENPN STSIIVEDHP FFLNNFPSPF LDDHESSLSL  60
IFSHQQKQQE LEASDHHPDA EIDPNNSRFE RANVKFIEDQ SSNPSAEPVS PSSRKRKLSA  120
KPRKRTEKKD RHSKICTAQG VRDRRMRLSL QIARKFFDLQ DMLAFDKASK TIEWLFSKSK  180
NAIKELSRNI PQEINDNSDQ NNLMSESHIL ECEDHRKLRK MESKDKPKAK TMENTKEKVM  240
IIGHKKGKEL YETNRKTVEA NSQSLENKFA NVGIMESYLG GTSSSISSIF DFENNGVRKG  300
SIDYFDNCYM GFLENWDNKN PNISCSTTTT NEVQIPFAGN NNTSSIDLDN FRYQFQFLDQ  360
ENHFSCRH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019264334.10.0PREDICTED: transcription factor TCP12-like
TrEMBLA0A314L4T70.0A0A314L4T7_NICAT; Transcription factor tcp12
STRINGXP_009760495.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24362359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.12e-32TCP domain protein 12